Human IGF2R domain 11. Determined by X-ray diffraction at 1.4 Å resolution. Released 28 Feb 2002.
Explore 1GP0 in 3D Show helices and sheets RCSB PDB PDBe
1GP0 contains 4 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1517-1519 | 3 | 1 |
| α-helix | 1525 | 1 | |
| β-strand | 1526-1528 | 3 | 1 |
| α-helix | 1530-1532 | 3 | |
| β-strand | 1533 | 1 | 2 |
| β-strand | 1538-1542 | 5 | 3 |
| β-strand | 1546-1550 | 5 | 3 |
| β-strand | 1552 | 1 | 2 |
| β-strand | 1563 | 1 | 4 |
| β-strand | 1565-1567 | 3 | 3 |
| β-strand | 1573 | 1 | 3 |
| β-strand | 1576 | 1 | 4 |
| β-strand | 1582-1584 | 3 | 5 |
| β-strand | 1587-1592 | 6 | 5 |
| β-strand | 1597 | 1 | 6 |
| α-helix | 1598 | 1 | |
| β-strand | 1605 | 1 | 6 |
| β-strand | 1607-1614 | 8 | 5 |
| β-strand | 1625-1630 | 6 | 5 |
| β-strand | 1635-1642 | 8 | 5 |
| α-helix | 1643-1645 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cation-independent mannose-6-phosphate receptor | A | protein | 143 | HOMO SAPIENS | P11717 (AlphaFold model) |
>1GP0_1 CATION-INDEPENDENT MANNOSE-6-PHOSPHATE RECEPTOR (chains A) MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACF GQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLI SLDKQTCTLFFSWHTPLACEQAT
Structure of a Functional Igf2R Fragment Determined from the Anomalous Scattering of Sulfur. Brown, J., Esnouf, R.M., Jones, M.A. et al. EMBO J (2002) 21:1054. DOI 10.1093/EMBOJ/21.5.1054 · PubMed
Other PDB entries of the same protein (UniProt P11717 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1GP0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.