1GP3: Human IGF2R domain 11

Human IGF2R domain 11. Determined by X-ray diffraction at 1.95 Å resolution. Released 28 Feb 2002.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,061
Mol. weight: 15.56 kDa
Released: 28 Feb 2002

Explore 1GP3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GP3 contains 4 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	1517-1519	3	1
α-helix	1525	1
β-strand	1526-1528	3	1
α-helix	1530-1532	3
β-strand	1538-1542	5	2
β-strand	1546-1550	5	2
β-strand	1563	1	3
β-strand	1565-1567	3	2
β-strand	1573	1	2
β-strand	1576	1	3
β-strand	1582-1584	3	4
β-strand	1587-1592	6	4
β-strand	1597	1	5
α-helix	1598	1
β-strand	1605	1	5
β-strand	1607-1614	8	4
β-strand	1625-1630	6	4
β-strand	1635-1642	8	4
α-helix	1643-1645	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cation-independent mannose-6-phosphate receptor	A	protein	143	HOMO SAPIENS	P11717 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1GP3_1 CATION-INDEPENDENT MANNOSE-6-PHOSPHATE RECEPTOR (chains A)
MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACF
GQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLI
SLDKQTCTLFFSWHTPLACEQAT

Primary citation

Structure of a Functional Igf2R Fragment Determined from the Anomalous Scattering of Sulfur. Brown, J., Esnouf, R.M., Jones, M.A. et al. EMBO J (2002) 21:1054. DOI 10.1093/EMBOJ/21.5.1054 · PubMed

Other PDB entries of the same protein (UniProt P11717 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GP0 1.4 Å, Human IGF2R domain 11
6Z30 1.5 Å, Human cation-independent mannose 6-phosphate/ IGF2 receptor domains 9-10
1E6F 1.75 Å, Human MIR-receptor, repeat 11
1GQB 1.8 Å, Human mir-receptor, repeat 11
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
6N5X 2.05 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
6N5Y 2.26 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
1LF8 2.3 Å, Complex of GGA3-VHS Domain and CI-MPR C-terminal Phosphopeptide
1JPL 2.4 Å, GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose…
6V02 2.46 Å, N-terminal 5 domains of CI-MPR
6P8I 2.54 Å, N-terminal 5 domains of IGFIIR
6Z31 2.56 Å, Human cation-independent mannose 6-phosphate/ IGF2 receptor domain 8

Browse structure collections

About this viewer

MolViewer shows 1GP3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.