1GQB: Human mir-receptor, repeat 11

Name: PDB 1GQB: Human mir-receptor, repeat 11
Published: 2002-12-05
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: receptor

Human mir-receptor, repeat 11. Determined by X-ray diffraction at 1.8 Å resolution. Released 5 Dec 2002.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,163
Mol. weight: 31.93 kDa
Released: 5 Dec 2002

Explore 1GQB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GQB contains 7 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	1
α-helix	18	1
β-strand	19-21	3	1
α-helix	23-25	3
β-strand	31-35	5	2
β-strand	39-43	5	2
β-strand	56	1	3
β-strand	58-60	3	2
β-strand	66	1	2
β-strand	69	1	3
β-strand	75-77	3	4
β-strand	80-85	6	4
α-helix	89	1
β-strand	90	1	5
α-helix	91	1
β-strand	98	1	5
β-strand	100-107	8	4
β-strand	118-123	6	4
β-strand	128-135	8	4
α-helix	136-138	3

Chain B: 2 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	6
β-strand	18-21	4	6
α-helix	23-25	3
β-strand	26	1	7
β-strand	31-35	5	8
β-strand	39-43	5	8
β-strand	45	1	7
β-strand	56	1	9
β-strand	58-60	3	8
β-strand	66	1	8
β-strand	69	1	9
β-strand	75-77	3	10
β-strand	80-85	6	10
β-strand	90	1	11
β-strand	98	1	11
β-strand	100-107	8	10
β-strand	118-123	6	10
β-strand	128-135	8	10
α-helix	136-138	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cation-independent mannose-6-phosphate receptor	A, B	protein	143	HOMO SAPIENS	P11717 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1GQB_1 CATION-INDEPENDENT MANNOSE-6-PHOSPHATE RECEPTOR (chains A, B)
MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACF
GQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLI
SLDKQTCTLFFSWHTPLACEQAT

Primary citation

Locating the Anomalous Scatterer Substructures in Halide and Sulfur Phasing. Uson, I., Schmidt, B., Von Buelow, R. et al. Acta Crystallogr D Biol Crystallogr (2003) 59:57. DOI 10.1107/S090744490201884X · PubMed

Other PDB entries of the same protein (UniProt P11717 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GP0 1.4 Å, Human IGF2R domain 11
6Z30 1.5 Å, Human cation-independent mannose 6-phosphate/ IGF2 receptor domains 9-10
1E6F 1.75 Å, Human MIR-receptor, repeat 11
1GP3 1.95 Å, Human IGF2R domain 11
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
6N5X 2.05 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
6N5Y 2.26 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
1LF8 2.3 Å, Complex of GGA3-VHS Domain and CI-MPR C-terminal Phosphopeptide
1JPL 2.4 Å, GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose…
6V02 2.46 Å, N-terminal 5 domains of CI-MPR
6P8I 2.54 Å, N-terminal 5 domains of IGFIIR
6Z31 2.56 Å, Human cation-independent mannose 6-phosphate/ IGF2 receptor domain 8

Browse structure collections

About this viewer

MolViewer shows 1GQB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.