1GU5: C/EBPBETA BZIP homodimer

Crystal structure of C/EBPBETA BZIP homodimer bound to a DNA fragment from the MIM-1 promoter. Determined by X-ray diffraction at 2.1 Å resolution. Released 26 Jun 2003.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: HOMO SAPIENS, SYNTHETIC CONSTRUCT
Chains: 4
Atoms: 2,003
Mol. weight: 28.56 kDa
Released: 26 Jun 2003

Explore 1GU5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GU5 contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	272-329	58

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	272-332	61

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Caat/enhancer binding protein beta	A, B	protein	78	HOMO SAPIENS	P17676 (AlphaFold model)
5'-d(tptpgptpgptptpgpgpcp* cpapaptpcp*a)-3'	C	DNA	16	SYNTHETIC CONSTRUCT
5'-d(aptpgpaptptpgpgpcpcp* apapcpapcp*a)-3'	D	DNA	16	SYNTHETIC CONSTRUCT

Sequence of entity 1 (A, B), FASTA

>1GU5_1 CAAT/ENHANCER BINDING PROTEIN BETA (chains A, B)
VKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVE
QLSRELSTLRNLFKQLPE

Sequence of entity 2 (C), FASTA

>1GU5_2 5'-D(*TP*TP*GP*TP*GP*TP*TP*GP*GP*CP* CP*AP*AP*TP*CP*A)-3' (chains C)
TTGTGTTGGCCAATCA

Sequence of entity 3 (D), FASTA

>1GU5_3 5'-D(*AP*TP*GP*AP*TP*TP*GP*GP*CP*CP* AP*AP*CP*AP*CP*A)-3' (chains D)
ATGATTGGCCAACACA

Primary citation

Structural Basis for Flexible Base Recognition by C/Ebpbeta. Tahirov, T.H., Inoue-Bungo, T., Sato, K. et al. To be published.

Other PDB entries of the same protein (UniProt P17676 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MG1 1.75 Å, C-terminal bZIP domain of human C/EBPbeta with 16bp Methylated Oligonucleotide…
7L4V 1.75 Å, C-terminal bZIP domain of human C/EBPbeta Bound to DNA with Consensus Recognition with…
1GU4 1.8 Å, Crystal structure of C/EBPBETA BZIP homodimer bound to a high affinity DNA fragment
2E42 1.8 Å, Crystal structure of C/EBPbeta Bzip homodimer V285A mutant bound to A High Affinity DNA…
1GTW 1.85 Å, crystal structure of C/EBPbeta bZip homodimer bound to a DNA fragment from the tom-1A…
6MG2 1.93 Å, C-terminal bZIP domain of human C/EBPbeta with 16bp Methylated Oligonucleotide…
6MG3 2.05 Å, V285A Mutant of the C-terminal bZIP domain of human C/EBPbeta with 16bp Methylated…
2E43 2.1 Å, Crystal structure of C/EBPbeta Bzip homodimer K269A mutant bound to A High Affinity DNA…
8K8D 2.2 Å, Crystal structure of C/EBPbeta BZIP domain bound to a high affinity DNA
1H8A 2.23 Å, Crystal structure of ternary protein-DNA COMPLEX3
1H89 2.45 Å, Crystal structure of ternary protein-DNA COMPLEX2
7UPZ 2.49 Å, Structural basis for cell type specific DNA binding of C/EBPbeta: the case of cell cycle…

Browse structure collections

About this viewer

MolViewer shows 1GU5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.