1GUX: Rb pocket

Rb pocket bound to E7 lxcxe motif. Determined by X-ray diffraction at 1.85 Å resolution. Released 2 Dec 1998.

Method: X-ray diffraction
Resolution: 1.85 Å
Organisms: Homo sapiens, Human papillomavirus
Chains: 3
Atoms: 3,097
Mol. weight: 44.53 kDa
Released: 2 Dec 1998

Explore 1GUX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GUX contains 23 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	381-391	11
α-helix	398-405	8
α-helix	412-434	23
α-helix	440-462	23
α-helix	473-478	6
α-helix	480-497	18
α-helix	516-520	5
α-helix	525-538	14
α-helix	544-559	16
α-helix	561-563	3
α-helix	568-576	9

Chain B: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	646-669	24
α-helix	676-690	15
α-helix	692-694	3
α-helix	700-714	15
α-helix	721-728	8
α-helix	737-740	4
β-strand	742-743	2	1
β-strand	749-750	2	1
α-helix	752-755	4
α-helix	756-760	5
α-helix	761-769	9
α-helix	770-772	3
α-helix	776-777	2
α-helix	779-784	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoblastoma protein	A	protein	218	Homo sapiens	P06400 (AlphaFold model)
Retinoblastoma protein	B	protein	152	Homo sapiens	P06400 (AlphaFold model)
Oncoprotein	E	protein	9	Human papillomavirus

Sequence of entity 1 (A), FASTA

>1GUX_1 RETINOBLASTOMA PROTEIN (chains A)
HTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFA
KAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACAL
EVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLE
RCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESA

Sequence of entity 2 (B), FASTA

>1GUX_2 RETINOBLASTOMA PROTEIN (chains B)
FQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELM
RDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVF
YNSVFMQRLKTNILQYASTRPPTLSPIPHIPR

Sequence of entity 3 (E), FASTA

>1GUX_3 ONCOPROTEIN (chains E)
DLYCYEQLN

Primary citation

Structure of the retinoblastoma tumour-suppressor pocket domain bound to a peptide from HPV E7. Lee, J.O., Russo, A.A., Pavletich, N.P. Nature (1998) 391:859-865. DOI 10.1038/36038 · PubMed

Other PDB entries of the same protein (UniProt P06400 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2R7G 1.67 Å, Structure of the retinoblastoma protein pocket domain in complex with adenovirus E1A CR1…
4ELL 1.98 Å, Structure of the inactive retinoblastoma protein pocket domain
2QDJ 2.0 Å, Crystal structure of the Retinoblastoma protein N-domain provides insight into tumor…
9DHU 2.16 Å, The Retinoblastoma Protein with Mutation E533K
1N4M 2.2 Å, Structure of Rb tumor suppressor bound to the transactivation domain of E2F-2
9DHF 2.26 Å, The Retinoblastoma Protein with Mutation E554K
1AD6 2.3 Å, Domain A of human retinoblastoma tumor suppressor
9DHC 2.32 Å, The Retinoblastoma Protein with Mutation S751Y
4CRI 2.35 Å, Crystal Structure of 53BP1 tandem tudor domains in complex with methylated K810 Rb peptide
9DGK 2.38 Å, The Retinoblastoma Protein with Mutation M704V
1H25 2.5 Å, CDK2/Cyclin A in complex with an 11-residue recruitment peptide from…
1PJM 2.5 Å, Mouse Importin alpha-bipartite NLS from human retinoblastoma protein Complex

Browse structure collections

About this viewer

MolViewer shows 1GUX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.