2QDJ: Retinoblastoma-associated protein

Crystal structure of the Retinoblastoma protein N-domain provides insight into tumor suppression, ligand interaction and holoprotein architecture. Determined by X-ray diffraction at 2.0 Å resolution. Released 22 Jan 2008.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,351
Mol. weight: 35.43 kDa
Released: 22 Jan 2008

Explore 2QDJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QDJ contains 19 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	55-63	9
α-helix	68-82	15
α-helix	95-110	16
α-helix	117-124	8
α-helix	128-135	8
α-helix	142-172	31
β-strand	173	1	1
β-strand	176	1	2
β-strand	185	1	2
α-helix	188-204	17
α-helix	212-228	17
α-helix	232-234	3
β-strand	235	1	1
α-helix	236	1
α-helix	241-243	3
α-helix	272-281	10
α-helix	285-291	7
α-helix	292-296	5
α-helix	297-299	3
α-helix	314-328	15
α-helix	333-338	6
α-helix	341-343	3
α-helix	347-353	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoblastoma-associated protein	A	protein	304	Homo sapiens	P06400 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2QDJ_1 Retinoblastoma-associated protein (chains A)
TEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLD
EMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCEL
IYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSP
PMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNV
YFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSF
ETQR

Primary citation

Crystal structure of the retinoblastoma protein N domain provides insight into tumor suppression, ligand interaction, and holoprotein architecture. Hassler, M., Singh, S., Yue, W.W. et al. Mol Cell (2007) 28:371-385. DOI 10.1016/j.molcel.2007.08.023 · PubMed

Other PDB entries of the same protein (UniProt P06400 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2R7G 1.67 Å, Structure of the retinoblastoma protein pocket domain in complex with adenovirus E1A CR1…
1GUX 1.85 Å, Rb pocket bound to E7 lxcxe motif
4ELL 1.98 Å, Structure of the inactive retinoblastoma protein pocket domain
9DHU 2.16 Å, The Retinoblastoma Protein with Mutation E533K
1N4M 2.2 Å, Structure of Rb tumor suppressor bound to the transactivation domain of E2F-2
9DHF 2.26 Å, The Retinoblastoma Protein with Mutation E554K
1AD6 2.3 Å, Domain A of human retinoblastoma tumor suppressor
9DHC 2.32 Å, The Retinoblastoma Protein with Mutation S751Y
4CRI 2.35 Å, Crystal Structure of 53BP1 tandem tudor domains in complex with methylated K810 Rb peptide
9DGK 2.38 Å, The Retinoblastoma Protein with Mutation M704V
1H25 2.5 Å, CDK2/Cyclin A in complex with an 11-residue recruitment peptide from…
1PJM 2.5 Å, Mouse Importin alpha-bipartite NLS from human retinoblastoma protein Complex

Browse structure collections

About this viewer

MolViewer shows 2QDJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.