1PJM: Retinoblastoma-associated protein

Mouse Importin alpha-bipartite NLS from human retinoblastoma protein Complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 19 Aug 2003.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,573
Mol. weight: 52.02 kDa
Released: 19 Aug 2003

Explore 1PJM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1PJM contains 33 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 33 helices, 0 β-strands

Element	Residues	Length
α-helix	78-86	9
α-helix	90-103	14
α-helix	112-117	6
α-helix	121-128	8
α-helix	131-133	3
α-helix	134-148	15
α-helix	152-160	9
α-helix	163-170	8
α-helix	176-191	16
α-helix	194-202	9
α-helix	206-212	7
α-helix	218-220	3
α-helix	223-236	14
α-helix	243-245	3
α-helix	246-259	14
α-helix	265-278	14
α-helix	283-290	8
α-helix	295-302	8
α-helix	307-320	14
α-helix	325-333	9
α-helix	336-339	4
α-helix	340-343	4
α-helix	349-362	14
α-helix	367-375	9
α-helix	379-387	9
α-helix	391-407	17
α-helix	410-418	9
α-helix	422-428	7
α-helix	434-452	19
α-helix	457-466	10
α-helix	470-473	4
α-helix	475-478	4
α-helix	482-494	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoblastoma-associated protein	A	protein	20		P06400 (AlphaFold model)
Importin alpha-2 subunit	B	protein	460	Mus musculus	P52293 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1PJM_1 Retinoblastoma-associated protein (chains A)
CGKRSAEGSNPPKPLKKLRG

Sequence of entity 2 (B), FASTA

>1PJM_2 Importin alpha-2 subunit (chains B)
NQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG
KTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI
AGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAV
EQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPI
VTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ
IQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLL
SAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASL
NLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF

Primary citation

Structural basis for the specificity of bipartite nuclear localization sequence binding by importin-alpha. Fontes, M.R.M., Teh, T., Jans, D. et al. J Biol Chem (2003) 278:27981-27987. DOI 10.1074/jbc.M303275200 · PubMed

Other PDB entries of the same protein (UniProt P06400 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2R7G 1.67 Å, Structure of the retinoblastoma protein pocket domain in complex with adenovirus E1A CR1…
1GUX 1.85 Å, Rb pocket bound to E7 lxcxe motif
4ELL 1.98 Å, Structure of the inactive retinoblastoma protein pocket domain
2QDJ 2.0 Å, Crystal structure of the Retinoblastoma protein N-domain provides insight into tumor…
9DHU 2.16 Å, The Retinoblastoma Protein with Mutation E533K
1N4M 2.2 Å, Structure of Rb tumor suppressor bound to the transactivation domain of E2F-2
9DHF 2.26 Å, The Retinoblastoma Protein with Mutation E554K
1AD6 2.3 Å, Domain A of human retinoblastoma tumor suppressor
9DHC 2.32 Å, The Retinoblastoma Protein with Mutation S751Y
4CRI 2.35 Å, Crystal Structure of 53BP1 tandem tudor domains in complex with methylated K810 Rb peptide
9DGK 2.38 Å, The Retinoblastoma Protein with Mutation M704V
1H25 2.5 Å, CDK2/Cyclin A in complex with an 11-residue recruitment peptide from…

Browse structure collections

About this viewer

MolViewer shows 1PJM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.