1GYW: PDB entry 1GYW

Gamma-adaptin appendage domain from clathrin adaptor AP1 A753D mutant. Determined by X-ray diffraction at 2.4 Å resolution. Released 22 Aug 2002.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: MUS MUSCULUS
Chains: 2
Atoms: 2,172
Mol. weight: 28.55 kDa
Released: 22 Aug 2002

Explore 1GYW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GYW contains 11 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	700-701	2
α-helix	704-706	3
β-strand	707-712	6	1
β-strand	715-723	9	1
β-strand	730-739	10	1
β-strand	745	1	2
β-strand	746-753	8	3
β-strand	759-762	4	1
α-helix	763-765	3
β-strand	770	1	2
α-helix	772-774	3
β-strand	778-785	8	1
α-helix	790-792	3
β-strand	794-802	9	3
β-strand	805-813	9	3
α-helix	818-820	3

Chain B: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	700-701	2
β-strand	707-712	6	4
β-strand	715-723	9	4
β-strand	730-739	10	4
β-strand	745	1	5
β-strand	746-753	8	6
β-strand	759-762	4	4
α-helix	763-765	3
β-strand	770	1	5
α-helix	772-774	3
β-strand	778-785	8	4
α-helix	790-792	3
β-strand	794-802	9	6
β-strand	805-813	9	6
α-helix	818-820	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Adapter-related protein complex 1 gamma 1 subunit	A, B	protein	128	MUS MUSCULUS	P22892 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1GYW_1 ADAPTER-RELATED PROTEIN COMPLEX 1 GAMMA 1 SUBUNIT (chains A, B)
PLFNDIAPGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQADV
PKTFQLQLLSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVN
NFPPQSWQ

Primary citation

Gamma-adaptin appendage domain: structure and binding site for Eps15 and gamma-synergin. Kent, H.M., McMahon, H.T., Evans, P.R. et al. Structure (2002) 10:1139-1148. DOI 10.1016/s0969-2126(02)00801-8 · PubMed

Other PDB entries of the same protein (UniProt P22892 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZY7 1.09 Å, Crystal structure of computationally redesigned gamma-adaptin appendage domain forming a…
2A7B 1.65 Å, On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The…
1GYV 1.71 Å, Gamma-adaptin appendage domain from clathrin adaptor AP1, L762E mutant
1GYU 1.81 Å, Gamma-adaptin appendage domain from clathrin adaptor AP1
7R4H 2.34 Å, phospho-STING binding to adaptor protein complex-1
4P6Z 3.0 Å, Crystal structure of the human BST2 cytoplasmic domain and the HIV-1 Vpu cytoplasmic…
6CM9 3.73 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef closed trimer monomeric subunit
6DFF 3.9 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef monomer
1W63 4.0 Å, AP1 clathrin adaptor core
6D83 4.27 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef (L164A, L165A) dileucine mutant…
6D84 6.72 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef (L164A, L165A) dileucine mutant dimer
6CRI 6.8 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef stable closed trimer

Browse structure collections

About this viewer

MolViewer shows 1GYW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.