1H2C: Matrix protein VP40

Ebola virus matrix protein VP40 N-terminal domain in complex with RNA (High-resolution VP40[55-194] variant). Determined by X-ray diffraction at 1.6 Å resolution. Released 10 Apr 2003.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: EBOLA VIRUS, ESCHERICHIA COLI
Chains: 2
Atoms: 1,195
Mol. weight: 16.26 kDa
Released: 10 Apr 2003

Explore 1H2C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1H2C contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	71-84	14	1
β-strand	87-101	15	1
α-helix	108-117	10
β-strand	120-125	6	1
β-strand	132-137	6	1
α-helix	148-151	4
β-strand	154-158	5	1
α-helix	159-162	4
β-strand	173-185	13	1
α-helix	186-187	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Matrix protein VP40	A	protein	140	EBOLA VIRUS	Q05128 (AlphaFold model)
5'-r(upgp*ap)-3'	R	RNA	3	ESCHERICHIA COLI

Sequence of entity 1 (A), FASTA

>1H2C_1 MATRIX PROTEIN VP40 (chains A)
ADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAA
IMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTF
DLTALKLITQPLPAATWTDD

Sequence of entity 2 (R), FASTA

>1H2C_2 5'-R(*UP*GP*AP)-3' (chains R)
UGA

Primary citation

The Matrix Protein Vp40 from Ebola Virus Octamerizes Into Pore-Like Structures with Specific RNA Binding Properties. Gomis-Ruth, F.X., Dessen, A., Timmins, J. et al. Structure (2003) 11:423. DOI 10.1016/S0969-2126(03)00050-9 · PubMed

Other PDB entries of the same protein (UniProt Q05128 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7K5L 1.38 Å, Ebola virus VP40 octameric ring generated by an RNA oligonucleotide
7K5D 1.78 Å, Ebola virus VP40 octameric ring generated by a DNA oligonucleotide
4LDM 1.85 Å, Crystal Structure of an RNA-free VP40 Octameric Ring
4EJE 2.2 Å, Structure Of The Tsg101 UEV Domain In Complex With an Ebola PTAP late Domain Peptide
7JZJ 2.46 Å, Crystal structure demonstrating CTD-CTD interactions of Zaire Ebola virus VP40 dimer
1H2D 2.6 Å, Ebola virus matrix protein VP40 N-terminal domain in complex with RNA (Low-resolution…
4LDB 3.1 Å, Crystal Structure of Ebola Virus VP40 Dimer
4LDD 3.5 Å, Crystal Structure of Ebola virus VP40 Hexamer
7JZT 3.77 Å, Low resolution crystal structure of Zaire Ebola virus VP40 in space group P6422
4LDI 4.15 Å, Low resolution structure of Ebola virus M241R mutant
2KQ0 Human NEDD4 3rd WW Domain Complex with Ebola Zaire Virus Matrix Protein VP40 Derived…

Browse structure collections

About this viewer

MolViewer shows 1H2C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.