2KQ0: E3 ubiquitin-protein ligase NEDD4

Name: PDB 2KQ0: Human NEDD4 3rd WW Domain Complex with Ebola Zaire Virus Matrix Protein VP40 Derived Peptide ILPTAPPEYMEA
Published: 2010-11-03
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Human NEDD4 3rd WW Domain Complex with Ebola Zaire Virus Matrix Protein VP40 Derived Peptide ILPTAPPEYMEA. Determined by solution NMR. Released 3 Nov 2010.

Method: Solution NMR
Organisms: Homo sapiens, Human T-cell lymphotrophic virus type 1 isolate Mel 15
Chains: 2
Atoms: 369
Mol. weight: 6.91 kDa
Released: 3 Nov 2010

Explore 2KQ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KQ0 contains 1 α-helix and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	17-22	6	1
β-strand	26-31	6	1
β-strand	36-38	3	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	114-116	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase NEDD4	A	protein	49	Homo sapiens	P46934 (AlphaFold model)
12-mer from Matrix protein VP40	B	protein	12	Human T-cell lymphotrophic virus type 1 isolate Mel 15	Q05128 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KQ0_1 E3 ubiquitin-protein ligase NEDD4 (chains A)
GAMGPSEIEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAH

Sequence of entity 2 (B), FASTA

>2KQ0_2 12-mer from Matrix protein VP40 (chains B)
ILPTAPPEYMEA

Primary citation

Human NEDD4 3rd WW Domain Complex with Ebola Zaire Virus Matrix Protein VP40 Derived Peptide. Iglesias-Bexiga, M. To be published.

Other PDB entries of the same protein (UniProt P46934 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N7F 1.1 Å, Crystal structure of 3rd WW domain of human Nedd4-1
4N7H 1.7 Å, Crystal Structure of the Complex of 3rd WW domain of Human Nedd4 and 1st PPXY Motif of…
3B7Y 1.8 Å, Crystal structure of the C2 Domain of the E3 Ubiquitin-Protein Ligase NEDD4
9H9O 2.12 Å, Crystal structure of NEDD4 HECT domain in complex with norclomipramine
9H9T 2.17 Å, Crystal structure of NEDD4 HECT domain in complex with covalent inhibitor
5C91 2.44 Å, NEDD4 HECT with covalently bound indole-based inhibitor
2XBF 2.5 Å, Nedd4 HECT structure
4BBN 2.51 Å, NEDD4 HECT-Ub:Ub complex
2XBB 2.68 Å, Nedd4 HECT:Ub complex
4BE8 3.0 Å, NEDD4 HECT A889F structure
5C7J 3.0 Å, Crystal structure of NEDD4 with a ub variant
2KPZ Human NEDD4 3RD WW Domain Complex with The Human T-cell Leukemia virus 1 GAG-Pro…

Browse structure collections

About this viewer

MolViewer shows 2KQ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.