4EJE: Tsg101 UEV Domain

Structure Of The Tsg101 UEV Domain In Complex With an Ebola PTAP late Domain Peptide. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Apr 2013.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Homo sapiens, Ebola virus
Chains: 4
Atoms: 2,529
Mol. weight: 38.58 kDa
Released: 10 Apr 2013

Explore 4EJE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4EJE contains 11 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
α-helix	18-31	14
β-strand	36-43	8	1
β-strand	49-63	15	1
β-strand	66-75	10	1
α-helix	84-85	2
β-strand	86-89	4	1
β-strand	95-97	3	2
β-strand	103	1	3
β-strand	108	1	1
β-strand	109	1	3
α-helix	112-115	4
α-helix	124-137	14
β-strand	141-143	3	2

Chain B: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	5-12	8
α-helix	18-31	14
β-strand	35-40	6	4
β-strand	52-63	12	4
β-strand	66-76	11	4
β-strand	85-89	5	4
β-strand	95-97	3	5
β-strand	103	1	6
β-strand	108	1	4
β-strand	109	1	6
α-helix	112-115	4
α-helix	124-137	14
β-strand	141-143	3	5

Chain C: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	6	1
β-strand	7	1	2
α-helix	8	1

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	7	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor susceptibility gene 101 protein	A, B	protein	159	Homo sapiens	Q99816 (AlphaFold model)
Matrix protein VP40	C, D	protein	9	Ebola virus	Q05128 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4EJE_1 Tumor susceptibility gene 101 protein (chains A, B)
MRGSHHHHHHGMASMAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFND
GSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDAN
GKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP

Sequence of entity 2 (C, D), FASTA

>4EJE_2 Matrix protein VP40 (chains C, D)
ILPTAPPEY

Primary citation

To be published. Camara-Artigas, A., Palencia, A., Andujar-Sanchez, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q99816 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NLC 1.4 Å, Crystallographic structure of human Tsg101 UEV domain in complex with a HEV ORF3 peptide
3OBQ 1.4 Å, Crystal Structure of the Tsg101 UEV domain in complex with a human HRS PSAP peptide
3OBS 1.5 Å, Crystal structure of Tsg101 UEV domain
3OBU 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP peptide
3OBX 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 Gag P7A mutant peptide
3P9G 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA459 peptide
3P9H 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA258 peptide
1S1Q 2.0 Å, TSG101(UEV) domain in complex with Ubiquitin
4YC1 2.0 Å, Structure of the human TSG101-UEV domain in the P321 space group
6VME 2.19 Å, Human ESCRT-I heterotetramer headpiece
7ZLX 2.25 Å, Crystal Structure of the TSG101-UEV domain:space group P21
2F0R 2.26 Å, Crystallographic structure of human Tsg101 UEV domain

Browse structure collections

About this viewer

MolViewer shows 4EJE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.