Aml1/cbf-beta/dna complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 31 Mar 2001.
Explore 1H9D in 3D Show helices and sheets RCSB PDB PDBe
1H9D contains 12 α-helices and 41 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 62-64 | 3 | 1 |
| β-strand | 70-73 | 4 | 1 |
| β-strand | 78-80 | 3 | 2 |
| α-helix | 83-85 | 3 | |
| β-strand | 90-93 | 4 | 1 |
| β-strand | 102-108 | 7 | 3 |
| β-strand | 117-118 | 2 | 4 |
| β-strand | 121-123 | 3 | 3 |
| β-strand | 124-125 | 2 | 1 |
| β-strand | 128-130 | 3 | 1 |
| α-helix | 131 | 1 | |
| β-strand | 135-136 | 2 | 4 |
| β-strand | 146-152 | 7 | 3 |
| β-strand | 158-166 | 9 | 3 |
| β-strand | 167-169 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-14 | 7 | |
| α-helix | 16-19 | 4 | |
| β-strand | 25-29 | 5 | 3 |
| α-helix | 37-49 | 13 | |
| β-strand | 52-57 | 6 | 3 |
| β-strand | 62-67 | 6 | 3 |
| β-strand | 86-87 | 2 | 3 |
| β-strand | 94-103 | 10 | 3 |
| β-strand | 106-115 | 10 | 3 |
| β-strand | 120-127 | 8 | 3 |
| α-helix | 129-134 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 62-64 | 3 | 5 |
| β-strand | 70-73 | 4 | 5 |
| β-strand | 78-80 | 3 | 6 |
| α-helix | 83-85 | 3 | |
| β-strand | 90-93 | 4 | 5 |
| β-strand | 102-108 | 7 | 7 |
| β-strand | 115 | 1 | 7 |
| β-strand | 117-118 | 2 | 8 |
| β-strand | 121-123 | 3 | 7 |
| β-strand | 124-125 | 2 | 5 |
| β-strand | 128-130 | 3 | 5 |
| α-helix | 131 | 1 | |
| β-strand | 135-136 | 2 | 8 |
| β-strand | 146-152 | 7 | 7 |
| β-strand | 158-166 | 9 | 7 |
| β-strand | 167-169 | 3 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-14 | 7 | |
| α-helix | 16-22 | 7 | |
| β-strand | 25-29 | 5 | 7 |
| α-helix | 37-49 | 13 | |
| β-strand | 52-57 | 6 | 7 |
| β-strand | 62-67 | 6 | 7 |
| β-strand | 86-87 | 2 | 7 |
| β-strand | 94-103 | 10 | 7 |
| β-strand | 106-115 | 10 | 7 |
| β-strand | 120-127 | 8 | 7 |
| α-helix | 129-134 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Core-binding factor alpha SUBUNIT1 | A, C | protein | 134 | HOMO SAPIENS | Q01196 (AlphaFold model) |
| Core-binding factor cbf-beta | B, D | protein | 134 | HOMO SAPIENS | Q13951 (AlphaFold model) |
| DNA (5'-(*gp*tp*tp*gp*cp*gp*gp*tp*tp*g)-3') | E, G | DNA | 10 | ||
| DNA (5'-(*cp*ap*ap*cp*cp*gp*cp*ap*ap*c)-3') | F, H | DNA | 10 |
>1H9D_1 CORE-BINDING FACTOR ALPHA SUBUNIT1 (chains A, C) SMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGN DENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKIT VDGPREPRRHRQKL
>1H9D_2 CORE-BINDING FACTOR CBF-BETA (chains B, D) PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATG TNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDG MGCLEFDEERAQQE
>1H9D_3 DNA (5'-(*GP*TP*TP*GP*CP*GP*GP*TP*TP*G)-3') (chains E, G) GTTGCGGTTG
>1H9D_4 DNA (5'-(*CP*AP*AP*CP*CP*GP*CP*AP*AP*C)-3') (chains F, H) CAACCGCAAC
The Leukemia-Associated Aml1 (Runx1)-Cbfbeta Complex Functions as a DNA-Induced Molecular Clamp. Bravo, J., Li, Z., Speck, N.A. et al. Nat Struct Biol (2001) 8:371. DOI 10.1038/86264 · PubMed
Other PDB entries of the same protein (UniProt Q01196 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1H9D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.