1H9O: Phosphatidylinositol 3-kinase

Phosphatidylinositol 3-kinase, P85-alpha subunit: C-terminal SH2 domain complexed with a TYR751 phosphopeptide from the pdgf receptor, crystal structure at 1.79 a. Determined by X-ray diffraction at 1.79 Å resolution. Released 19 Mar 2001.

Method: X-ray diffraction
Resolution: 1.79 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,034
Mol. weight: 13.31 kDa
Released: 19 Mar 2001

Explore 1H9O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1H9O contains 6 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
α-helix	9-11	3
β-strand	13	1	1
α-helix	19-26	8
α-helix	29-30	2
β-strand	33-38	6	1
β-strand	45-51	7	1
β-strand	54-60	7	1
β-strand	61-63	3	2
β-strand	66-68	3	2
β-strand	76	1	2
α-helix	79-88	10
α-helix	91-93	3
β-strand	104-105	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3-kinase	A	protein	112	HOMO SAPIENS	P27986 (AlphaFold model)
Beta-platelet-derived growth factor receptor	B	protein	5	HOMO SAPIENS	P09619 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1H9O_1 PHOSPHATIDYLINOSITOL 3-KINASE (chains A)
GSPIPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVI
NKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR

Sequence of entity 2 (B), FASTA

>1H9O_2 BETA-PLATELET-DERIVED GROWTH FACTOR RECEPTOR (chains B)
YVPML

Primary citation

NMR Trial Models: Experiences with the Colicin Immunity Protein Im7 and the P85Alpha C-Terminal Sh2-Peptide Complex. Pauptit, R.A., Dennis, C.A., Derbyshire, D.J. et al. Acta Crystallogr D Biol Crystallogr (2001) 57:1397. DOI 10.1107/S0907444901012434 · PubMed

Other PDB entries of the same protein (UniProt P27986 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GJI 0.9 Å, PI3K p85 N-terminal SH2 domain/CD28-derived peptide complex
5AUL 1.1 Å, PI3K p85 C-terminal SH2 domain/CD28-derived peptide complex
7CIO 1.1 Å, Molecular interactions of cytoplasmic region of CTLA-4 with SH2 domains of PI3-kinase
7RNS 1.14 Å, nSH2 domain of p85-alpha subunit of phosphatidylinositol 3-kinase in complex with an…
3I5R 1.7 Å, PI3K SH3 domain in complex with a peptide ligand
2IUG 1.89 Å, Crystal structure of the PI3-kinase p85 N-terminal SH2 domain
1PBW 2.0 Å, Structure of BCR-homology (BH) domain
1PHT 2.0 Å, Phosphatidylinositol 3-kinase P85-alpha subunit SH3 domain, residues 1-85
2IUH 2.0 Å, Crystal structure of the PI3-kinase p85 N-terminal SH2 domain in complex with c-Kit…
4JPS 2.2 Å, Co-crystal Structures of the Lipid Kinase PI3K alpha with Pan and Isoform Selective…
7PG5 2.2 Å, Crystal Structure of PI3Kalpha
6PYR 2.21 Å, Human PI3Kdelta in complex with Compound 2-10 ((3S)-3-benzyl-3-methyl-5-[5-(2-methylpyrim…

Browse structure collections

About this viewer

MolViewer shows 1H9O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.