5AUL: PDB entry 5AUL

PI3K p85 C-terminal SH2 domain/CD28-derived peptide complex. Determined by X-ray diffraction at 1.1 Å resolution. Released 25 May 2016.

Method: X-ray diffraction
Resolution: 1.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,295
Mol. weight: 13.33 kDa
Released: 25 May 2016

Explore 5AUL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5AUL contains 7 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	613-615	3
α-helix	617-619	3
α-helix	621-623	3
β-strand	625	1	1
α-helix	631-638	8
α-helix	641-642	2
β-strand	645-650	6	1
β-strand	657-663	7	1
β-strand	666-672	7	1
β-strand	673-675	3	2
β-strand	678-680	3	2
β-strand	688	1	2
α-helix	691-698	8
α-helix	703-705	3
β-strand	716-717	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3-kinase regulatory subunit alpha	A	protein	109	Homo sapiens	P27986 (AlphaFold model)
T-cell-specific surface glycoprotein CD28	B	protein	8	Homo sapiens	P10747 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5AUL_1 Phosphatidylinositol 3-kinase regulatory subunit alpha (chains A)
GSEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCV
INKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA

Sequence of entity 2 (B), FASTA

>5AUL_2 T-cell-specific surface glycoprotein CD28 (chains B)
SDYMNMTP

Primary citation

Crystal Structures and Thermodynamic Analysis Reveal Distinct Mechanisms of CD28 Phosphopeptide Binding to the Src Homology 2 (SH2) Domains of Three Adaptor Proteins. Inaba, S., Numoto, N., Ogawa, S. et al. J Biol Chem (2017) 292:1052-1060. DOI 10.1074/jbc.M116.755173 · PubMed

Other PDB entries of the same protein (UniProt P27986 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GJI 0.9 Å, PI3K p85 N-terminal SH2 domain/CD28-derived peptide complex
7CIO 1.1 Å, Molecular interactions of cytoplasmic region of CTLA-4 with SH2 domains of PI3-kinase
7RNS 1.14 Å, nSH2 domain of p85-alpha subunit of phosphatidylinositol 3-kinase in complex with an…
3I5R 1.7 Å, PI3K SH3 domain in complex with a peptide ligand
1H9O 1.79 Å, Phosphatidylinositol 3-kinase, P85-alpha subunit: C-terminal SH2 domain complexed with a…
2IUG 1.89 Å, Crystal structure of the PI3-kinase p85 N-terminal SH2 domain
1PBW 2.0 Å, Structure of BCR-homology (BH) domain
1PHT 2.0 Å, Phosphatidylinositol 3-kinase P85-alpha subunit SH3 domain, residues 1-85
2IUH 2.0 Å, Crystal structure of the PI3-kinase p85 N-terminal SH2 domain in complex with c-Kit…
4JPS 2.2 Å, Co-crystal Structures of the Lipid Kinase PI3K alpha with Pan and Isoform Selective…
7PG5 2.2 Å, Crystal Structure of PI3Kalpha
6PYR 2.21 Å, Human PI3Kdelta in complex with Compound 2-10 ((3S)-3-benzyl-3-methyl-5-[5-(2-methylpyrim…

Browse structure collections

About this viewer

MolViewer shows 5AUL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.