Solution structure of the a-subunit of human chorionic gonadotropin [modeled with diantennary glycan at ASN78]. Determined by solution NMR. Released 7 Dec 2000.
Explore 1HD4 in 3D Show helices and sheets RCSB PDB PDBe
1HD4 contains 0 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 20 | 1 | 1 |
| β-strand | 23 | 1 | 1 |
| β-strand | 60 | 1 | 2 |
| β-strand | 64 | 1 | 3 |
| β-strand | 70 | 1 | 4 |
| β-strand | 74 | 1 | 4 |
| β-strand | 81 | 1 | 3 |
| β-strand | 84 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chorionic gonadotropin | A | protein | 92 | HOMO SAPIENS | P01215 (AlphaFold model) |
>1HD4_1 CHORIONIC GONADOTROPIN (chains A) APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Effects of the N-Linked Glycans on the 3D Structure of the Free A-Subunit of Human Chorionic Gonadotropin. Erbel, P.J.A., Karimi-Nejad, Y., van Kuik, J.A. et al. Biochemistry (2000) 39:6012-6021. DOI 10.1021/BI992786N · PubMed
Other PDB entries of the same protein (UniProt P01215 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1HD4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.