1HDJ: Human HSP40 (hdj-1), NMR

Human HSP40 (hdj-1), NMR. Determined by solution NMR. Released 8 Nov 1996.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 626
Mol. weight: 8.92 kDa
Released: 8 Nov 1996

Explore 1HDJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HDJ contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
β-strand	12	1	1
β-strand	14	1	1
α-helix	16-28	13
α-helix	40-53	14
α-helix	57-65	9
α-helix	68-70	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human HSP40	A	protein	77	Homo sapiens	P25685 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HDJ_1 HUMAN HSP40 (chains A)
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK
REIFDRYGEEGLKGSGC

Primary citation

Nuclear magnetic resonance solution structure of the human Hsp40 (HDJ-1) J-domain. Qian, Y.Q., Patel, D., Hartl, F.U. et al. J Mol Biol (1996) 260:224-235. DOI 10.1006/jmbi.1996.0394 · PubMed

Other PDB entries of the same protein (UniProt P25685 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AGX 1.85 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain
3AGY 1.85 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal…
4WB7 1.9 Å, Crystal structure of a chimeric fusion of human DnaJ (Hsp40) and cAMP-dependent protein…
8FE2 2.34 Å, Structure of J-PKAc chimera complexed with Aplithianine A
9NFS 2.45 Å, Structure of J-PKAc chimera in complex with Aplithianine j1
3AGZ 2.51 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal…
8FE5 2.51 Å, Structure of J-PKAc chimera complexed with Aplithianine B
7NDX 2.54 Å, Crystal structure of the human HSP40 DNAJB1-CTDs in complex with a peptide of NudC
2QLD 2.7 Å, human Hsp40 Hdj1
8FEC 2.7 Å, Structure of J-PKAc chimera complexed with Aplithianine derivative
6BYR 3.66 Å, Structures of the PKA RI alpha holoenzyme with the FLHCC driver J-PKAc alpha or native…
6WJG 6.2 Å, PKA RIIbeta holoenzyme with DnaJB1-PKAc fusion in fibrolamellar hepatoceullar carcinoma

Browse structure collections

About this viewer

MolViewer shows 1HDJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.