The high-resolution structure of the histidine-containing phosphocarrier protein hpr from escherichia coli determined by restrained molecular dynamics from NMR nuclear overhauser effect data. Determined by solution NMR. Released 22 Jun 1994.
Explore 1HDN in 3D Show helices and sheets RCSB PDB PDBe
1HDN contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 1 |
| α-helix | 16-27 | 12 | |
| β-strand | 32-37 | 6 | 1 |
| β-strand | 40-43 | 4 | 1 |
| α-helix | 47-52 | 6 | |
| β-strand | 58-66 | 9 | 1 |
| α-helix | 70-83 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histidine-containing phosphocarrier protein hpr | A | protein | 85 | Escherichia coli | P0AA04 (AlphaFold model) |
>1HDN_1 HISTIDINE-CONTAINING PHOSPHOCARRIER PROTEIN HPR (chains A) MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTV VTISAEGEDEQKAVEHLVKLMAELE
The high-resolution structure of the histidine-containing phosphocarrier protein HPr from Escherichia coli determined by restrained molecular dynamics from nuclear magnetic resonance nuclear Overhauser effect data. van Nuland, N.A., Hangyi, I.W., van Schaik, R.C. et al. J Mol Biol (1994) 237:544-559. DOI 10.1006/jmbi.1994.1254 · PubMed
Other PDB entries of the same protein (UniProt P0AA04 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1HDN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.