1HEI: Hepatitis C virus RNA helicase domain

Name: PDB 1HEI: Structure of the hepatitis C virus RNA helicase domain
Published: 1998-10-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: helicase

Structure of the hepatitis C virus RNA helicase domain. Determined by X-ray diffraction at 2.1 Å resolution. Released 7 Oct 1998.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Hepatitis C virus (isolate 1)
Chains: 2
Atoms: 6,759
Mol. weight: 96.8 kDa
Ligands: CA
Released: 7 Oct 1998

Explore 1HEI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HEI contains 29 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	190-194	5
β-strand	198-200	3	1
α-helix	213-220	8
β-strand	225-229	5	1
α-helix	232-245	14
β-strand	251-254	4	1
β-strand	257-259	3	1
β-strand	265-269	5	1
α-helix	270-275	6
β-strand	286-290	5	1
α-helix	297-309	13
β-strand	317-321	5	1
β-strand	336-340	5	2
β-strand	342	1	3
β-strand	347-349	3	3
β-strand	352-354	3	3
α-helix	356-359	4
β-strand	363-367	5	2
α-helix	371-383	13
β-strand	388-391	4	2
β-strand	406-410	5	2
β-strand	424-427	4	2
β-strand	430-437	8	4
β-strand	445-452	8	4
β-strand	454	1	5
α-helix	455-462	8
β-strand	471-475	5	2
β-strand	481	1	5
β-strand	485	1	6
α-helix	488-501	14
α-helix	506-518	13
β-strand	524	1	6
α-helix	529-538	10
α-helix	544-552	9
α-helix	558-571	14
α-helix	580-585	6
β-strand	596-597	2	7
β-strand	601	1	4
β-strand	609-610	2	7
α-helix	614-626	13

Chain B: 14 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	198-200	3	8
α-helix	213-220	8
β-strand	225-229	5	8
β-strand	265-269	5	8
α-helix	270-275	6
β-strand	286-289	4	8
α-helix	297-309	13
α-helix	311-313	3
β-strand	317-320	4	8
β-strand	337-340	4	9
β-strand	347	1	10
β-strand	354	1	10
α-helix	356-359	4
β-strand	364-367	4	9
α-helix	371-382	12
β-strand	388-391	4	9
β-strand	407-410	4	9
β-strand	424-427	4	9
β-strand	430-437	8	11
β-strand	445-452	8	11
α-helix	455-462	8
β-strand	472-475	4	9
α-helix	488-500	13
α-helix	506-518	13
α-helix	529-537	9
α-helix	544-552	9
α-helix	558-571	14
α-helix	580-585	6
β-strand	596-597	2	12
β-strand	601	1	11
β-strand	609-610	2	12
α-helix	614-626	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HCV helicase	A, B	protein	451	Hepatitis C virus (isolate 1)	P27958 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1HEI_1 HCV HELICASE (chains A, B)
RSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFG
AYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATS
ILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVI
KGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTNGDVVVVSTDALMTGFT
GDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPG
ERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGL
THIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLL
YRLGAVQNEVTLTHPITKYIMTCMSADLEVV

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Structure of the hepatitis C virus RNA helicase domain. Yao, N., Hesson, T., Cable, M. et al. Nat Struct Biol (1997) 4:463-467. DOI 10.1038/nsb0697-463 · PubMed

Other PDB entries of the same protein (UniProt P27958 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BZY 1.6 Å, Structure of the Hepatitis C virus envelope glycoprotein E2 antigenic region 412-423…
5FGB 1.65 Å, Three dimensional structure of broadly neutralizing human anti - Hepatitis C virus (HCV)…
6BQJ 1.69 Å, Crystal structure of hepatis C virus protease (NS3) complexed with tripeptidic acyl…
2XI3 1.7 Å, HCV-H77 NS5B Polymerase Complexed With GTP
4N0Y 1.75 Å, Structure of the Hepatitis C Envelope Glycoprotein E1 antigenic region 314-324 bound to…
2XI2 1.8 Å, HCV-H77 NS5B Apo Polymerase
6UYD 1.9 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2mc3-v1 redesigned core from…
5FGC 1.9 Å, Three dimensional structure of broadly neutralizing human anti - Hepatitis C virus (HCV)…
6BQK 1.97 Å, Crystal structure of hepatis C virus protease (NS3) complexed with tripeptidic acyl…
5EOC 1.98 Å, Crystal structure of Fab C2 in complex with a Cyclic variant of Hepatitis C Virus E2…
2O8M 2.0 Å, Crystal structure of the S139A mutant of Hepatitis C Virus NS3/4A protease
4XVJ 2.0 Å, Structure of the hepatitis C virus envelope glycoprotein E2 antigenic 2 region 412-423…

Browse structure collections

About this viewer

MolViewer shows 1HEI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.