1HGU: Human growth hormone

Name: PDB 1HGU: Human growth hormone
Published: 1995-12-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: hormone

Human growth hormone. Determined by X-ray diffraction at 2.5 Å resolution. Released 7 Dec 1995.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,575
Mol. weight: 21.9 kDa
Released: 7 Dec 1995

Explore 1HGU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HGU contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	7-33	27
α-helix	41-43	3
α-helix	47-49	3
α-helix	72-86	15
α-helix	95-98	4
α-helix	111-120	10
α-helix	155-168	14
α-helix	171-181	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human growth hormone	A	protein	191	Homo sapiens	P01241 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HGU_1 HUMAN GROWTH HORMONE (chains A)
FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYSFLQAPQASLCFSESIPT
PSNREQAQQKSNLQLLRISLLLIQSWLEPVGFLRSVFANSLVYGASDSDVYDLLKDLEEG
IQTLMGRLEDGSPRTGQAFKQTYAKFDANSHNDDALLKNYGLLYCFRKDMDKVETFLRIV
QCRSVEGSCGF

Primary citation

THE CRYSTAL-STRUCTURE OF WILD-TYPE GROWTH-HORMONE AT 2.5 ANGSTROM RESOLUTION. Chantalat, L., Jones, N.D., Korber, F. et al. Protein Pept Lett (1995) 2:333-340. PubMed

Other PDB entries of the same protein (UniProt P01241 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HUW 2.0 Å, The crystal structure of affinity-matured human growth hormone at 2 Å resolution
1AXI 2.1 Å, Structural plasticity at the hgh:hghbp interface
1HWG 2.5 Å, 1:2 complex of human growth hormone with its soluble binding protein
1A22 2.6 Å, Human growth hormone bound to single receptor
1KF9 2.6 Å, Phage display derived variant of human growth hormone complexed with two copies of the…
3HHR 2.8 Å, Human growth hormone and extracellular domain of its receptor: crystal structure of the…
1BP3 2.9 Å, The xray structure of a growth hormone-prolactin receptor complex
1HWH 2.9 Å, 1:1 complex of human growth hormone mutant G120R with its soluble binding protein

Browse more

1HGU is part of these collections:

Insulin and hormones

About this viewer

MolViewer shows 1HGU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.