1HLZ: Orphan nuclear receptor NR1D1

Crystal structure of the orphan nuclear receptor rev-erb(alpha) DNA-binding domain bound to its cognate response element. Determined by X-ray diffraction at 2.8 Å resolution. Released 16 Nov 2001.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,987
Mol. weight: 34.33 kDa
Ligands: ZN
Released: 16 Nov 2001

Explore 1HLZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HLZ contains 11 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	0	1	1
β-strand	7	1	1
α-helix	8	1
β-strand	10-12	3	2
β-strand	15-17	3	2
α-helix	19-29	11
α-helix	33-36	5
α-helix	50-52	3
α-helix	54-64	11
α-helix	68-70	3

Chain B: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	0	1	3
α-helix	6	1
β-strand	7	1	3
α-helix	8	1
β-strand	10-12	3	4
β-strand	15-17	3	4
α-helix	19-29	11
α-helix	54-62	9
α-helix	68-70	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(cpapapcptpapgpgptpcpapcptpapgpgptpcpapg)-3'	C	DNA	20
5'-d(cptpgpapcpcptpapgptpgpapcpcptpapgptptpg)-3'	D	DNA	20
Orphan nuclear receptor NR1D1	A, B	protein	94	Homo sapiens	P20393 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>1HLZ_1 5'-D(*CP*AP*AP*CP*TP*AP*GP*GP*TP*CP*AP*CP*TP*AP*GP*GP*TP*CP*AP*G)-3' (chains C)
CAACTAGGTCACTAGGTCAG

Sequence of entity 2 (D), FASTA

>1HLZ_2 5'-D(*CP*TP*GP*AP*CP*CP*TP*AP*GP*TP*GP*AP*CP*CP*TP*AP*GP*TP*TP*G)-3' (chains D)
CTGACCTAGTGACCTAGTTG

Sequence of entity 3 (A, B), FASTA

>1HLZ_3 ORPHAN NUCLEAR RECEPTOR NR1D1 (chains A, B)
TKLNGMVLLCKVCGDVASGFHYGVLACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINR
NRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRM

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

DNA Deformability as a Recognition Feature in the RevErb Response Element. Sierk, M.L., Zhao, Q., Rastinejad, F. Biochemistry (2001) 40:12833-12843. DOI 10.1021/bi011086r · PubMed

Other PDB entries of the same protein (UniProt P20393 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1A6Y 2.3 Å, Reverba orphan nuclear receptor/dna complex
1GA5 2.4 Å, Crystal structure of the orphan nuclear receptor rev-erb(alpha) DNA-binding domain bound…
8D8I 2.5 Å, Crystal structure of Reverb alpha in complex with synthetic agonist
3N00 2.6 Å, Crystal Structure of a deletion mutant of human Reverba ligand binding domain bound with…

Browse structure collections

About this viewer

MolViewer shows 1HLZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.