1HRP: Human chorionic gonadotropin

Crystal structure of human chorionic gonadotropin. Determined by X-ray diffraction at 3.0 Å resolution. Released 1 Nov 1994.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,550
Mol. weight: 27.06 kDa
Ligands: NAG
Released: 1 Nov 1994

Explore 1HRP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HRP contains 5 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
β-strand	11-20	10	2
β-strand	23-38	16	2
α-helix	39-40	2
α-helix	41-44	4
β-strand	53-57	5	2
β-strand	58-62	5	3
β-strand	65-67	3	4
β-strand	70	1	5
β-strand	74	1	5
β-strand	76	1	6
β-strand	77-79	3	4
β-strand	82-86	5	3

Chain B: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	1
β-strand	8	1	2
β-strand	10-18	9	2
β-strand	21	1	7
β-strand	23	1	7
β-strand	27-41	15	2
β-strand	45	1	6
α-helix	53-54	2
β-strand	55-59	5	8
β-strand	62-65	4	9
β-strand	68	1	10
α-helix	69	1
α-helix	72-73	2
β-strand	79	1	10
β-strand	82-85	4	9
β-strand	88-92	5	8
β-strand	98-101	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human chorionic gonadotropin	A	protein	92	Homo sapiens	P01215 (AlphaFold model)
Human chorionic gonadotropin	B	protein	145		P0DN86 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HRP_1 HUMAN CHORIONIC GONADOTROPIN (chains A)
APDTQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Sequence of entity 2 (B), FASTA

>1HRP_2 HUMAN CHORIONIC GONADOTROPIN (chains B)
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR
DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS
SKAPPPSLPSPSRLPGPSDTPILPQ

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Crystal structure of human chorionic gonadotropin. Lapthorn, A.J., Harris, D.C., Littlejohn, A. et al. Nature (1994) 369:455-461. DOI 10.1038/369455a0 · PubMed

Other PDB entries of the same protein (UniProt P01215 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9YXD 2.29 Å, Crystal structure of recombinant human follicle stimulating hormone in complex with an…
7UTZ 2.4 Å, Human thyrotropin analog TR1402 bound to human Thyrotropin receptor in complex with…
4AY9 2.5 Å, Structure of follicle-stimulating hormone in complex with the entire ectodomain of its…
1HCN 2.6 Å, Structure of human chorionic gonadotropin at 2.6 Å resolution from mad analysis of the…
8I2G 2.8 Å, FSHR-Follicle stimulating hormone-compound 716340-Gs complex
4MQW 2.9 Å, Structure of follicle-stimulating hormone in complex with the entire ectodomain of its…
7T9I 2.9 Å, Native human TSH bound to human Thyrotropin receptor in complex with miniGs399…
1XWD 2.92 Å, Crystal Structure of Human Follicle Stimulating Hormone Complexed with its Receptor
7XW5 2.96 Å, TSHR-thyroid stimulating hormone-Gs-ML109 complex
1FL7 3.0 Å, Human follicle stimulating hormone
7FIH 3.2 Å, luteinizing hormone/choriogonadotropin receptor(S277I)-chorionic…
1QFW 3.5 Å, Ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti…

Browse structure collections

About this viewer

MolViewer shows 1HRP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.