1HUW: Affinity-matured human growth hormone

Name: PDB 1HUW: The crystal structure of affinity-matured human growth hormone at 2 Å resolution
Published: 1994-01-31
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: hormone

The crystal structure of affinity-matured human growth hormone at 2 Å resolution. Determined by X-ray diffraction at 2.0 Å resolution. Released 31 Jan 1994.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,438
Mol. weight: 21.99 kDa
Released: 31 Jan 1994

Explore 1HUW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HUW contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	6-35	30
α-helix	38-46	9
α-helix	64-68	5
α-helix	72-84	13
α-helix	89-93	5
α-helix	94-99	6
α-helix	110-128	19
α-helix	156-183	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human growth hormone	A	protein	191	Homo sapiens	P01241 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HUW_1 HUMAN GROWTH HORMONE (chains A)
FPTIPLSRLADNAWLRADRLNQLAFDTYQEFEEAYIPKEQIHSFWWNPQTSLCPSESIPT
PSNKEETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEG
IQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFNKDMSKVSTYLRTV
QCRSVEGSCGF

Primary citation

The crystal structure of affinity-matured human growth hormone at 2 A resolution. Ultsch, M.H., Somers, W., Kossiakoff, A.A. et al. J Mol Biol (1994) 236:286-299. DOI 10.1006/jmbi.1994.1135 · PubMed

Other PDB entries of the same protein (UniProt P01241 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1AXI 2.1 Å, Structural plasticity at the hgh:hghbp interface
1HGU 2.5 Å, Human growth hormone
1HWG 2.5 Å, 1:2 complex of human growth hormone with its soluble binding protein
1A22 2.6 Å, Human growth hormone bound to single receptor
1KF9 2.6 Å, Phage display derived variant of human growth hormone complexed with two copies of the…
3HHR 2.8 Å, Human growth hormone and extracellular domain of its receptor: crystal structure of the…
1BP3 2.9 Å, The xray structure of a growth hormone-prolactin receptor complex
1HWH 2.9 Å, 1:1 complex of human growth hormone mutant G120R with its soluble binding protein

Browse structure collections

About this viewer

MolViewer shows 1HUW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.