1HXM: Human Vgamma9/Vdelta2 T Cell Receptor

Crystal Structure of a Human Vgamma9/Vdelta2 T Cell Receptor. Determined by X-ray diffraction at 3.12 Å resolution. Released 20 Jun 2001.

Method: X-ray diffraction
Resolution: 3.12 Å
Organism: Homo sapiens
Chains: 8
Atoms: 13,820
Mol. weight: 211.78 kDa
Released: 20 Jun 2001

Explore 1HXM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HXM contains 50 α-helices and 173 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
β-strand	10-14	5	2
β-strand	19-25	7	1
α-helix	30-32	3
β-strand	34-41	8	2
β-strand	47-51	5	2
β-strand	55-56	2	2
β-strand	64-69	6	1
α-helix	70-72	3
β-strand	74-79	6	1
α-helix	84-86	3
β-strand	88-95	8	2
β-strand	108-109	2	2
β-strand	110	1	1
β-strand	113-118	6	2
β-strand	125	1	3
α-helix	126-127	2
β-strand	128-134	7	4
β-strand	137-143	7	4
β-strand	146	1	3
β-strand	151-155	5	5
β-strand	159-162	4	4
β-strand	166-169	4	4
β-strand	175-183	9	4
β-strand	190-195	6	5
β-strand	198-201	4	5
α-helix	202-205	4

Chain B: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	6
β-strand	10-14	5	7
β-strand	19-26	8	6
β-strand	31	1	8
β-strand	33	1	8
α-helix	34	1
β-strand	35-40	6	7
β-strand	47-52	6	7
β-strand	58-60	3	7
α-helix	64-65	2
β-strand	69-74	6	6
β-strand	79-84	6	6
α-helix	89-91	3
β-strand	93-102	10	7
β-strand	109-113	5	7
β-strand	117-122	6	7
α-helix	132	1
β-strand	133	1	9
α-helix	134	1
α-helix	138-140	3
α-helix	141-145	5
β-strand	150-159	10	9
β-strand	164-170	7	10
β-strand	180-181	2	9
β-strand	185-186	2	9
β-strand	191-199	9	9
α-helix	202-205	4
β-strand	208-214	7	10
α-helix	218-220	3
β-strand	223-227	5	10

Chain C: 3 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	11
β-strand	10-14	5	12
β-strand	19-26	8	11
β-strand	33	1	13
β-strand	36-41	6	12
β-strand	47-51	5	12
β-strand	55-56	2	12
β-strand	64-69	6	11
β-strand	74-79	6	11
α-helix	84-86	3
β-strand	88-94	7	12
β-strand	96	1	13
β-strand	108-109	2	12
β-strand	110	1	11
β-strand	113-118	6	12
β-strand	125	1	14
α-helix	126-127	2
β-strand	128-134	7	15
β-strand	137-143	7	15
β-strand	146	1	14
β-strand	151-155	5	16
β-strand	159-162	4	15
β-strand	166-169	4	15
β-strand	175-183	9	15
β-strand	190-195	6	16
β-strand	198-201	4	16
α-helix	202-205	4

Chain D: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	17
β-strand	10-14	5	18
β-strand	19-26	8	17
β-strand	31	1	19
β-strand	33	1	19
β-strand	35-40	6	18
β-strand	47-52	6	18
β-strand	58-60	3	18
α-helix	64-65	2
β-strand	69-70	2	17
β-strand	73-74	2	17
β-strand	79-84	6	17
α-helix	89-91	3
β-strand	93-102	10	18
β-strand	109-113	5	18
β-strand	117-122	6	18
α-helix	132	1
β-strand	133	1	20
α-helix	134	1
α-helix	138-140	3
α-helix	141-145	5
β-strand	150-159	10	20
β-strand	164-170	7	21
β-strand	180-181	2	20
β-strand	185-186	2	20
β-strand	191-199	9	20
α-helix	202-205	4
β-strand	208-214	7	21
α-helix	218-220	3
β-strand	223-227	5	21

Chain E: 3 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	22
β-strand	10-14	5	23
β-strand	19-26	8	22
β-strand	33-41	9	23
β-strand	47-51	5	23
β-strand	55-56	2	23
β-strand	64-69	6	22
α-helix	70-72	3
β-strand	74-79	6	22
α-helix	84-86	3
β-strand	88-96	9	23
β-strand	108-109	2	23
β-strand	110	1	22
β-strand	113-118	6	23
β-strand	125	1	24
β-strand	128-134	7	25
β-strand	137-143	7	25
β-strand	146	1	24
β-strand	151-155	5	26
β-strand	159-162	4	25
β-strand	166-169	4	25
β-strand	175-183	9	25
β-strand	190-195	6	26
β-strand	198-201	4	26
α-helix	202-205	4

Chain F: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	27
β-strand	10-14	5	28
β-strand	19-26	8	27
α-helix	30-32	3
β-strand	35-40	6	28
β-strand	47-52	6	28
β-strand	58-60	3	28
α-helix	64-65	2
β-strand	69-74	6	27
β-strand	79-84	6	27
α-helix	89-91	3
β-strand	93-102	10	28
β-strand	109-113	5	28
β-strand	117-122	6	28
α-helix	132	1
β-strand	133	1	29
α-helix	134	1
α-helix	138-140	3
α-helix	141-145	5
β-strand	150-159	10	29
β-strand	164-170	7	30
β-strand	180-181	2	29
β-strand	185-186	2	29
β-strand	191-199	9	29
α-helix	202-205	4
β-strand	208-214	7	30
α-helix	218-220	3
β-strand	223-227	5	30

Chain G: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	31
β-strand	10-14	5	32
β-strand	19-26	8	31
α-helix	30-32	3
β-strand	33-41	9	32
β-strand	47-51	5	32
β-strand	55-56	2	32
β-strand	64-69	6	31
α-helix	70-72	3
β-strand	74-79	6	31
α-helix	84-86	3
β-strand	88-96	9	32
β-strand	108-109	2	32
β-strand	110	1	31
β-strand	113-118	6	32
α-helix	119-120	2
β-strand	125	1	33
β-strand	128-134	7	34
β-strand	137-145	9	34
β-strand	146	1	33
β-strand	151-155	5	35
β-strand	159-162	4	34
β-strand	166-169	4	34
β-strand	175-183	9	34
β-strand	190-195	6	35
β-strand	198-201	4	35
α-helix	202-205	4

Chain H: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	36
β-strand	10-14	5	37
β-strand	19-26	8	36
β-strand	31	1	38
β-strand	33	1	38
β-strand	35-40	6	37
β-strand	47-52	6	37
β-strand	58-60	3	37
α-helix	64-65	2
β-strand	69-74	6	36
β-strand	79-84	6	36
α-helix	89-91	3
β-strand	93-102	10	37
β-strand	109-113	5	37
β-strand	117-122	6	37
α-helix	132	1
β-strand	133	1	39
α-helix	134	1
α-helix	138-140	3
α-helix	141-145	5
β-strand	150-159	10	39
β-strand	164-168	5	40
β-strand	180-181	2	39
β-strand	185-186	2	39
β-strand	191-199	9	39
α-helix	202-205	4
β-strand	208-214	7	40
α-helix	218-220	3
β-strand	223-227	5	40

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-delta T-cell receptor	A, C, E, G	protein	229	Homo sapiens	B7Z8K6 (AlphaFold model)
Gamma-delta T-cell receptor	B, D, F, H	protein	242	Homo sapiens	P03986 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>1HXM_1 GAMMA-DELTA T-CELL RECEPTOR (chains A, C, E, G)
AIELVPEHQTVPVSIGVPATLRCSMKGEAIGNYYINWYRKTQGNTMTFIYREKDIYGPGF
KDNFQGDIDIAKNLAVLKILAPSERDEGSYYCACDTLGMGGEYTDKLIFGKGTRVTVEPR
SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKL
GKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKS

Sequence of entity 2 (B, D, F, H), FASTA

>1HXM_2 GAMMA-DELTA T-CELL RECEPTOR (chains B, D, F, H)
AGHLEQPQISSTKTLSKTARLECVVSGITISATSVYWYRERPGEVIQFLVSISYDGTVRK
ESGIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALWEAQQELGKKIKVFGPGTKLI
ITDKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWEEKKSNTILGSQ
EGNTMKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK
DN

Primary citation

Structure of a human gammadelta T-cell antigen receptor. Allison, T.J., Winter, C.C., Fournie, J.J. et al. Nature (2001) 411:820-824. DOI 10.1038/35081115 · PubMed

Other PDB entries of the same protein (UniProt B7Z8K6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CI8 3.01 Å, T cell receptor complex
8JBV 3.02 Å, Extracellular domain of gamma delta TCR
9JY2 3.24 Å, Fab-CD3-delta epsilon-TCR complex
9JY3 3.35 Å, delta epsilon/gamma epsilon Fab-TCR tetramer
9CIA 3.39 Å, T cell receptor complex
8JC0 3.4 Å, V gamma9 V delta2 TCR and CD3 complex in LMNG
8WY0 3.8 Å, T cell receptor delta 2 gamma 9 with F283A, F290A, and F291A
8WYI 3.9 Å, T cell receptor delta 2 gamma 9 with TCRD TM domain chimera of TRAC
8WXE 4.0 Å, Vgamma5Vdelta1 EH TCR-CD3 complex
8YC0 4.12 Å, T cell receptor V delta2 V gamma9 in GDN
8JCB 9.5 Å, Vgamma5 Vdelta1 T cell receptor complex

Browse structure collections

About this viewer

MolViewer shows 1HXM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.