9CIA: T cell receptor complex
T cell receptor complex. Determined by electron microscopy at 3.39 Å resolution. Released 31 Jul 2024.
- Method
- Electron microscopy
- Resolution
- 3.39 Å
- Organism
- Homo sapiens
- Chains
- 12
- Atoms
- 7,918
- Mol. weight
- 118.42 kDa
- Ligands
- CLR
- Released
- 31 Jul 2024
Explore 9CIA in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9CIA contains 18 α-helices and 85 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain a: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 31-54 | 24 | |
Chain A: 0 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 22-24 | 3 | 1 |
| β-strand | 34-39 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 63-66 | 4 | 1 |
| β-strand | 72-76 | 5 | 1 |
| β-strand | 86-91 | 6 | 2 |
| β-strand | 98 | 1 | 3 |
| β-strand | 103-104 | 2 | 2 |
Chain b: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-53 | 26 | |
Chain B: 1 helix, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-6 | 4 | 4 |
| β-strand | 18-19 | 2 | 4 |
| β-strand | 22-25 | 4 | 4 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-40 | 7 | 3 |
| β-strand | 44-51 | 8 | 3 |
| β-strand | 58-60 | 3 | 3 |
| β-strand | 68-73 | 6 | 4 |
| β-strand | 78-83 | 6 | 4 |
| β-strand | 93-98 | 6 | 3 |
| β-strand | 99 | 1 | 5 |
| β-strand | 109 | 1 | 5 |
| β-strand | 111 | 1 | 2 |
| β-strand | 116-117 | 2 | 3 |
Chain C: 1 helix, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6 | 1 | 6 |
| β-strand | 11-13 | 3 | 7 |
| β-strand | 20-25 | 6 | 6 |
| β-strand | 34-39 | 6 | 7 |
| β-strand | 45-50 | 6 | 7 |
| β-strand | 54-55 | 2 | 7 |
| α-helix | 56 | 1 | |
| β-strand | 63-68 | 6 | 6 |
| β-strand | 71-76 | 6 | 6 |
| β-strand | 86-91 | 6 | 7 |
| β-strand | 99 | 1 | 7 |
| β-strand | 103-106 | 4 | 7 |
Chain d: 1 helix, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 26-29 | 4 | 20 |
| β-strand | 32-36 | 5 | 20 |
| β-strand | 41-46 | 6 | 14 |
| β-strand | 57-62 | 6 | 20 |
| β-strand | 69-73 | 5 | 14 |
| β-strand | 86-91 | 6 | 14 |
| β-strand | 96 | 1 | 15 |
| α-helix | 101-123 | 23 | |
Chain D: 4 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3 | 1 | 8 |
| β-strand | 6 | 1 | 9 |
| α-helix | 7-9 | 3 | |
| β-strand | 11 | 1 | 10 |
| α-helix | 12-13 | 2 | |
| β-strand | 17-23 | 7 | 9 |
| β-strand | 25 | 1 | 8 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-40 | 8 | 11 |
| β-strand | 44-51 | 8 | 11 |
| β-strand | 58-60 | 3 | 11 |
| β-strand | 70-73 | 4 | 9 |
| β-strand | 78-84 | 7 | 9 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-99 | 8 | 11 |
| β-strand | 111-112 | 2 | 11 |
| β-strand | 116-118 | 3 | 11 |
| β-strand | 119 | 1 | 10 |
Chain e: 1 helix, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 39-40 | 2 | 12 |
| β-strand | 44-47 | 4 | 12 |
| β-strand | 57-61 | 5 | 13 |
| β-strand | 64-66 | 3 | 13 |
| β-strand | 75-78 | 4 | 12 |
| β-strand | 81-85 | 5 | 12 |
| β-strand | 94-96 | 3 | 14 |
| β-strand | 97-100 | 4 | 13 |
| β-strand | 111-116 | 6 | 14 |
| β-strand | 124 | 1 | 15 |
| α-helix | 127-154 | 28 | |
4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| UCHT1 Fab 2 | A, C | protein | 107 | Homo sapiens | |
| UCHT1 Fab chain | B, D | protein | 120 | Homo sapiens | |
| T-cell surface glycoprotein CD3 zeta chain | a, b | protein | 29 | Homo sapiens | P20963 (AlphaFold model) |
| T-cell surface glycoprotein CD3 epsilon chain | e, f | protein | 123 | Homo sapiens | P07766 (AlphaFold model) |
| T cell receptor delta constant | m | protein | 35 | Homo sapiens | B7Z8K6 (AlphaFold model) |
| T cell receptor gamma constant 1 | n | protein | 36 | Homo sapiens | P0CF51 (AlphaFold model) |
| T-cell surface glycoprotein CD3 delta chain | d | protein | 106 | Homo sapiens | P04234 |
| T-cell surface glycoprotein CD3 gamma chain | g | protein | 114 | Homo sapiens | P09693 |
Sequence of entity 1 (A, C), FASTA
>9CIA_1 UCHT1 Fab 2 (chains A, C)
MDIQMTQTTSSLSASLGDRVTISCRASQDIRNYLNWYQQKPDGTVKLLIYYTSRLHSGVP
SKFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPWTFAGGTKLEI
Sequence of entity 2 (B, D), FASTA
>9CIA_2 UCHT1 Fab chain (chains B, D)
EVQLQQSGPELVKPGASMKISCKASGYSFTGYTMNWVKQSHGKNLEWMGLINPYKGVSTY
NQKFKDKATLTVDKSSSTAYMELLSLTSEDSAVYYCARSGYYGDSDWYFDVWGQGTTLTV
Sequence of entity 3 (a, b), FASTA
>9CIA_3 T-cell surface glycoprotein CD3 zeta chain (chains a, b)
LDPKLCYLLDGILFIYGVILTALFLRVKF
Sequence of entity 4 (e, f), FASTA
>9CIA_4 T-cell surface glycoprotein CD3 epsilon chain (chains e, f)
QTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQ
SGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWS
KNR
Sequence of entity 5 (m), FASTA
>9CIA_5 T cell receptor delta constant (chains m)
HTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFF
Sequence of entity 6 (n), FASTA
>9CIA_6 T cell receptor gamma constant 1 (chains n)
TLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRR
Sequence of entity 7 (d), FASTA
>9CIA_7 T-cell surface glycoprotein CD3 delta chain (chains d)
FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKD
KESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAG
Sequence of entity 8 (g), FASTA
>9CIA_8 T-cell surface glycoprotein CD3 gamma chain (chains g)
IKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGM
YQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAG
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CLR | Cholesterol | C27 H46 O | 1 |
Primary citation
Structure of a fully assembled gamma delta T cell antigen receptor. Gully, B.S., Ferreira Fernandes, J., Gunasinghe, S.D. et al. Nature (2024) 634:729-736. DOI 10.1038/s41586-024-07920-0 · PubMed
Other PDB entries of the same protein (UniProt P20963 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2OQ1 1.9 Å, Tandem SH2 domains of ZAP-70 with 19-mer zeta1 peptide
- 3IK5 2.05 Å, SIVmac239 Nef in complex with TCR zeta ITAM 1 polypeptide (A63-R80)
- 8ES8 2.65 Å, CryoEM structure of PN45545 TCR-CD3 in complex with HLA-A2 MAGEA4 (230-239)
- 4XZ1 2.8 Å, ZAP-70-tSH2:Compound-B adduct
- 1YGR 2.9 Å, Crystal structure of the tandem phosphatase domain of RPTP CD45
- 7FJE 3.0 Å, Cryo-EM structure of a membrane protein(LL)
- 9CI8 3.01 Å, T cell receptor complex
- 8ES7 3.04 Å, CryoEM structure of PN45545 TCR-CD3 complex
- 7PHR 3.08 Å, Structure of a fully assembled T-cell receptor engaging a tumor-associated peptide-MHC I
- 9JY1 3.08 Å, delta epsilon/delta epsilon Fab-TCR tetramer
- 7FJF 3.1 Å, Cryo-EM structure of a membrane protein(CS)
- 8TW6 3.1 Å, TCR in nanodisc ND-II
Browse structure collections
About this viewer
MolViewer shows 9CIA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.