1HYI: EEA1 fyve domain

Solution structure of the EEA1 fyve domain complexed with inositol 1,3-bisphosphate. Determined by solution NMR. Released 14 Mar 2001.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 521
Mol. weight: 7.7 kDa
Ligands: ITP, ZN
Released: 14 Mar 2001

Explore 1HYI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HYI contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	25-27	3	1
β-strand	34-36	3	1
β-strand	42-46	5	2
β-strand	51-55	5	2
α-helix	57-63	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endosome-associated protein	A	protein	65	Homo sapiens	Q15075 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HYI_1 ENDOSOME-ASSOCIATED PROTEIN (chains A)
RKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACF
NDLQG

Ligands and cofactors

ID	Name	Formula	Copies
ITP	Phosphoric acid mono-(2,3,4,6-tetrahydroxy-5-phosphonooxy-cyclohexyl) ester	C6 H14 O12 P2	1
ZN	Zinc ion	Zn	2

Primary citation

Structural mechanism of endosome docking by the FYVE domain. Kutateladze, T., Overduin, M. Science (2001) 291:1793-1796. DOI 10.1126/science.291.5509.1793 · PubMed

Other PDB entries of the same protein (UniProt Q15075 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MJH 2.03 Å, Crystal Structure of Human Rab5A in complex with the C2H2 Zinc Finger of EEA1
1JOC 2.2 Å, EEA1 homodimer of C-terminal FYVE domain bound to inositol 1,3-diphosphate
1HYJ Solution structure of the EEA1 fyve domain

Browse structure collections

About this viewer

MolViewer shows 1HYI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.