1JOC: EEA1 homodimer of C-terminal FYVE domain

EEA1 homodimer of C-terminal FYVE domain bound to inositol 1,3-diphosphate. Determined by X-ray diffraction at 2.2 Å resolution. Released 28 Dec 2001.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,025
Mol. weight: 29.22 kDa
Ligands: ITP, ZN
Released: 28 Dec 2001

Explore 1JOC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JOC contains 11 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	1290-1346	57
α-helix	1349-1351	3
α-helix	1352-1354	3
β-strand	1357	1	1
α-helix	1363	1
β-strand	1364	1	1
α-helix	1365	1
β-strand	1372-1373	2	2
β-strand	1380-1381	2	2
α-helix	1383-1385	3
β-strand	1388-1390	3	3
β-strand	1399-1401	3	3
α-helix	1403-1408	6

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	1290-1344	55
α-helix	1352-1354	3
β-strand	1357	1	4
β-strand	1364	1	4
β-strand	1372-1373	2	5
β-strand	1380-1381	2	5
α-helix	1383-1385	3
β-strand	1388-1390	3	6
β-strand	1399-1401	3	6
α-helix	1403-1408	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Early Endosomal Autoantigen 1	A, B	protein	125	Homo sapiens	Q15075 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1JOC_1 Early Endosomal Autoantigen 1 (chains A, B)
NNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALN
RKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACF
NDLQG

Ligands and cofactors

ID	Name	Formula	Copies
ITP	Phosphoric acid mono-(2,3,4,6-tetrahydroxy-5-phosphonooxy-cyclohexyl) ester	C6 H14 O12 P2	2
ZN	Zinc ion	Zn	4

Primary citation

Multivalent endosome targeting by homodimeric EEA1. Dumas, J.J., Merithew, E., Sudharshan, E. et al. Mol Cell (2001) 8:947-958. DOI 10.1016/S1097-2765(01)00385-9 · PubMed

Other PDB entries of the same protein (UniProt Q15075 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MJH 2.03 Å, Crystal Structure of Human Rab5A in complex with the C2H2 Zinc Finger of EEA1
1HYI Solution structure of the EEA1 fyve domain complexed with inositol 1,3-bisphosphate
1HYJ Solution structure of the EEA1 fyve domain

Browse structure collections

About this viewer

MolViewer shows 1JOC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.