1HZH: Immunoglobulin heavy chain

Crystal structure of the intact human IgG B12 with broad and potent activity against primary HIV-1 isolates: a template for HIV vaccine design. Determined by X-ray diffraction at 2.7 Å resolution. Released 15 Aug 2001.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 4
Atoms: 10,647
Mol. weight: 151.63 kDa
Released: 15 Aug 2001

Explore 1HZH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HZH contains 40 α-helices and 132 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 14 helices, 42 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
β-strand	10-12	3	2
β-strand	18-20	3	1
β-strand	22-25	4	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	46-52	7	2
β-strand	56-59	4	2
β-strand	67-72	6	1
β-strand	77-82	6	1
α-helix	84-86	3
β-strand	88-94	7	2
β-strand	102	1	2
β-strand	107-111	5	2
β-strand	117	1	3
β-strand	120-124	5	4
β-strand	138-145	8	4
β-strand	147	1	4
β-strand	148	1	3
β-strand	153-157	4	5
β-strand	166	1	5
β-strand	171-178	8	4
β-strand	185-193	9	4
α-helix	196-199	4
β-strand	207-212	6	5
α-helix	213-215	3
β-strand	217-222	6	5
α-helix	227-229	3
β-strand	252-256	5	6
α-helix	257-259	3
α-helix	260-264	5
β-strand	272-277	6	6
β-strand	287-292	6	7
β-strand	299-301	3	7
β-strand	305-311	7	6
β-strand	319-325	7	6
α-helix	329-334	6
β-strand	338-343	6	7
β-strand	351-355	5	7
β-strand	365	1	8
α-helix	366-367	2
β-strand	368-372	5	9
α-helix	373-375	3
α-helix	376-382	5
β-strand	385-395	11	9
β-strand	396	1	8
β-strand	401-408	6	10
β-strand	414-415	2	10
β-strand	419-421	3	9
α-helix	422-424	3
β-strand	425-426	2	9
β-strand	435-444	10	9
α-helix	445-449	5
β-strand	454-459	6	10
α-helix	464-466	3
β-strand	468-472	5	10

Chain K: 17 helices, 46 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	11
α-helix	7-9	3
β-strand	10-12	3	12
β-strand	17-25	9	11
α-helix	29-31	3
β-strand	34-39	6	12
β-strand	45-52	8	12
β-strand	56-59	4	12
β-strand	67-72	6	11
β-strand	77-82A	7	11
β-strand	88-94	7	12
α-helix	100C	1
β-strand	102-103	2	12
β-strand	107-111	5	12
β-strand	117	1	13
β-strand	120-121	2	14
β-strand	124	1	15
β-strand	138-139	2	16
β-strand	141	1	15
β-strand	142-147	6	14
β-strand	148	1	13
β-strand	153	1	17
β-strand	157	1	17
β-strand	171-173	3	14
α-helix	174-176	3
β-strand	178-179	2	14
β-strand	184-191	8	14
β-strand	192-193	2	16
α-helix	195-197	3
β-strand	207-212	6	17
β-strand	217-222	6	17
α-helix	243-245	3
β-strand	252-256	5	18
α-helix	257-259	3
α-helix	260-264	5
β-strand	271-279	9	18
β-strand	287-292	6	19
β-strand	299-301	3	19
β-strand	305-306	2	18
α-helix	307-309	3
β-strand	310-311	2	18
β-strand	319-326	8	18
α-helix	329-333	5
β-strand	338-343	6	19
β-strand	351-355	5	19
α-helix	358-360	3
β-strand	365	1	20
α-helix	366-367	2
β-strand	368-372	5	21
α-helix	373-375	3
α-helix	376-382	5
β-strand	385-395	11	21
β-strand	396	1	20
β-strand	401-408	6	22
β-strand	414-415	2	22
β-strand	419-421	3	21
α-helix	422-424	3
β-strand	425-426	2	21
β-strand	435-444	10	21
α-helix	445-449	5
β-strand	454-459	6	22
α-helix	464-466	3
β-strand	467-472	6	22

Chain L: 4 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	23
β-strand	10-13	4	2
β-strand	19-25	7	23
β-strand	33-38	6	2
β-strand	45-48	4	2
β-strand	54	1	2
α-helix	55	1
β-strand	62-67	6	23
β-strand	70-75	6	23
β-strand	85-90	6	2
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	111	1	24
β-strand	114-118	5	25
α-helix	119-121	3
α-helix	124-126	3
β-strand	129-139	11	25
β-strand	140	1	24
β-strand	145-150	6	26
β-strand	154	1	26
β-strand	159-160	2	25
β-strand	163	1	25
β-strand	173-182	10	25
α-helix	183-186	4
β-strand	191-197	7	26
β-strand	205-210	6	26

Chain M: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	27
β-strand	10-13	4	12
β-strand	19-25	7	27
β-strand	33-38	6	12
β-strand	45-49	5	12
β-strand	53-54	2	12
α-helix	55	1
β-strand	62-67	6	27
β-strand	70-75	6	27
α-helix	80-82	3
β-strand	84-90	7	12
β-strand	97-98	2	12
β-strand	102-106	5	12
β-strand	111	1	28
β-strand	116-117	2	29
α-helix	118-121	4
α-helix	122-125	4
β-strand	130-139	10	29
β-strand	140	1	28
β-strand	146-150	5	30
β-strand	154	1	30
β-strand	159-160	2	29
β-strand	163	1	29
β-strand	173-181	9	29
α-helix	183-186	4
β-strand	191-196	6	30
β-strand	205-210	6	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin heavy chain	H, K	protein	457	Homo sapiens	P01857 (AlphaFold model)
IMMUNOGLOBULIN LIGHT CHAIN,Uncharacterized protein	L, M	protein	215	Homo sapiens	P01834 (AlphaFold model)

Sequence of entity 1 (H, K), FASTA

>1HZH_1 IMMUNOGLOBULIN HEAVY CHAIN (chains H, K)
QVQLVQSGAEVKKPGASVKVSCQASGYRFSNFVIHWVRQAPGQRFEWMGWINPYNGNKEF
SAKFQDRVTFTADTSANTAYMELRSLRSADTAVYYCARVGPYSWDDSPQDNYYMDVWGKG
TTVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF
PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCP
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT
LPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL
TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Sequence of entity 2 (L, M), FASTA

>1HZH_2 IMMUNOGLOBULIN LIGHT CHAIN,Uncharacterized protein (chains L, M)
EIVLTQSPGTLSLSPGERATFSCRSSHSIRSRRVAWYQHKPGQAPRLVIHGVSNRASGIS
DRFSGSGSGTDFTLTITRVEPEDFALYYCQVYGASSYTFGQGTKLERKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLRSPVTKSFNRGEC

Primary citation

Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design. Saphire, E.O., Parren, P.W., Pantophlet, R. et al. Science (2001) 293:1155-1159. DOI 10.1126/science.1061692 · PubMed

Other PDB entries of the same protein (UniProt P01857 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LLD 1.19 Å, Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain…
3TV3 1.29 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT128 in complex with…
4LLQ 1.42 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
5HSF 1.52 Å, 1.52 Angstrom Crystal Structure of Fc fragment of Human IgG1.
6YT7 1.55 Å, Glycosylated knob/dummy-hole fc fragment
4NWU 1.6 Å, Crystal structure of APE1551, an anti-human NGF Fab with a nine amino acid insertion in…
1L6X 1.65 Å, Fc fragment of rituximab bound to a minimized version of the B-domain from protein A…
3TWC 1.65 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT127 in complex with…
5JIH 1.66 Å, Crystal structure of HER2 binding IgG1-Fc (Fcab STAB19)
3MCL 1.7 Å, Anti-beta-amyloid antibody c706 fab in space group P21
5U66 1.7 Å, Modified single helix from the B-domain of protein A bound to IgG1 Fc
6N35 1.75 Å, Anti-HIV-1 Fab 2G12 + Man1-2 re-refinement

Browse more

1HZH is part of these collections:

Antibodies and the immune system

About this viewer

MolViewer shows 1HZH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.