1HZI: Interleukin-4 mutant E9A

Interleukin-4 mutant E9A. Determined by X-ray diffraction at 2.05 Å resolution. Released 29 Aug 2001.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,214
Mol. weight: 15.41 kDa
Released: 29 Aug 2001

Explore 1HZI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HZI contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-18	13
β-strand	28-30	3	1
α-helix	32-34	3
α-helix	41-59	19
α-helix	70-94	25
β-strand	106-108	3	1
α-helix	109-127	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-4	A	protein	129	Homo sapiens	P05112 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HZI_1 INTERLEUKIN-4 (chains A)
HKCDITLQAIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHE
KDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIM
REKYSKCSS

Primary citation

Structure of interleukin 4 mutant E9A suggests polar steering in receptor-complex formation. Hulsmeyer, M., Scheufler, C., Dreyer, M.K. Acta Crystallogr D Biol Crystallogr (2001) 57:1334-1336. DOI 10.1107/S0907444901009799 · PubMed

Other PDB entries of the same protein (UniProt P05112 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2D48 1.65 Å, Crystal structure of the Interleukin-4 variant T13D
2B8X 1.7 Å, Crystal structure of the interleukin-4 variant F82D
2B8U 1.8 Å, Crystal structure of wildtype human Interleukin-4
2B8Y 1.8 Å, Crystal structure of the interleukin-4 variant T13DF82D
2B91 2.0 Å, Crystal structure of the interleukin-4 variant F82DR85A
4YDY 2.0 Å, Crystal structure of darpin 44C12V5 in complex with human il-4
2B90 2.1 Å, Crystal structure of the interleukin-4 variant T13DR85A
1RCB 2.25 Å, Crystal structure of human recombinant interleukin-4 at 2.25 Å resolution
1IAR 2.3 Å, Interleukin-4 / receptor alpha chain complex
2INT 2.35 Å, Crystal structure of recombinant human interleukin-4
2B8Z 2.5 Å, Crystal structure of the interleukin-4 variant R85A
5FHX 2.55 Å, Crystal structure of codv in complex with IL4 at 2.55 ang. Resolution.

Browse structure collections

About this viewer

MolViewer shows 1HZI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.