1I1C: Non-fcrn binding fc fragment of rat IGG2A

Non-fcrn binding fc fragment of rat IGG2A. Determined by X-ray diffraction at 2.7 Å resolution. Released 14 Feb 2001.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 3,440
Mol. weight: 56.23 kDa
Released: 14 Feb 2001

Explore 1I1C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1I1C contains 20 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 10 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	240-243	4	1
α-helix	244-246	3
α-helix	247-250	4
β-strand	258-266	9	1
β-strand	274-279	6	2
β-strand	283-284	2	2
β-strand	288-289	2	1
α-helix	290-292	3
β-strand	293-294	2	1
β-strand	300-307	8	1
α-helix	310-314	5
α-helix	317-318	2
β-strand	319-324	6	2
β-strand	332-336	5	2
β-strand	344	1	3
β-strand	347-351	5	4
α-helix	352-354	3
α-helix	355-359	5
β-strand	362-372	11	4
β-strand	373	1	3
β-strand	378-383	6	5
β-strand	386-387	2	5
β-strand	391-393	3	4
α-helix	394-396	3
β-strand	397-398	2	4
β-strand	404-413	10	4
α-helix	414-418	5
β-strand	423-428	6	5
α-helix	433-435	3
β-strand	436-441	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ig gamma-2A chain C region	A, B	protein	239	Rattus norvegicus	P20760 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1I1C_1 IG GAMMA-2A CHAIN C REGION (chains A, B)
VPRECNPCGCTGSEVSSVFIFPPKTKDVLGGGLTPKVTCVVVDISQNDPEVRFSWFIDDV
EVHTAQTHAPEKQSNSTLRSVSELPIVERDWLNGKTFKCKVNSGAFPAPIEKSISKPEGT
PRGPQVYTMAPPKEEMTQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDG
SYFLYSKLNVKKETWQQGNTFTCSVLHEGLENEHTEKSLSHSPGKGIEGRGSSHHHHHH

Primary citation

Crystal structure at 2.8 A of an FcRn/heterodimeric Fc complex: mechanism of pH-dependent binding. Martin, W.L., West Jr., A.P., Gan, L. et al. Mol Cell (2001) 7:867-877. DOI 10.1016/S1097-2765(01)00230-1 · PubMed

Other PDB entries of the same protein (UniProt P20760 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FN4 2.8 Å, Crystal structure of FAB198, an efficient protector of acetylcholine receptor against…
1I1A 2.8 Å, Crystal structure of the neonatal fc receptor complexed with a heterodimeric fc
4UAO 3.1 Å, Crystal structure of Apical Membrane Antigen 1 from Plasmodium Knowlesi in complex with…

Browse structure collections

About this viewer

MolViewer shows 1I1C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.