1I27: Transcription factor iif

Name: PDB 1I27: Crystal structure of the C-terminal domain of the RAP74 subunit of human transcription factor iif (TFIIF)
Published: 2001-03-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of the C-terminal domain of the RAP74 subunit of human transcription factor iif (TFIIF). Determined by X-ray diffraction at 1.02 Å resolution. Released 7 Mar 2001.

Method: X-ray diffraction
Resolution: 1.02 Å
Organism: Homo sapiens
Chains: 1
Atoms: 768
Mol. weight: 8.44 kDa
Ligands: ZN
Released: 7 Mar 2001

Explore 1I27 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1I27 contains 6 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	446-448	3
α-helix	456-465	10
β-strand	468	1	1
α-helix	470-475	6
α-helix	479-482	4
α-helix	486-500	15
α-helix	502	1
β-strand	503-507	5	1
β-strand	510-514	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor iif	A	protein	73	Homo sapiens	P35269 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1I27_1 TRANSCRIPTION FACTOR IIF (chains A)
GPLGSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPER
KMINDKMHFSLKE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Crystal structure of the C-terminal domain of the RAP74 subunit of human transcription factor IIF. Kamada, K., De Angelis, J., Roeder, R.G. et al. Proc Natl Acad Sci U S A (2001) 98:3115-3120. DOI 10.1073/pnas.051631098 · PubMed

Other PDB entries of the same protein (UniProt P35269 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1F3U 1.7 Å, Crystal structure of the RAP30/74 interaction domains of human tfiif
1J2X 2.0 Å, Crystal structure of RAP74 C-terminal domain complexed with FCP1 C-terminal peptide
7NVU 2.5 Å, RNA polymerase II core pre-initiation complex with open promoter DNA
8WAV 2.72 Å, De novo transcribing complex 12 (TC12), the early elongation complex with Pol II…
8WAX 2.75 Å, De novo transcribing complex 14 (TC14), the early elongation complex with Pol II…
8WAZ 2.76 Å, De novo transcribing complex 16 (TC16), the early elongation complex with Pol II…
8WAU 2.78 Å, De novo transcribing complex 11 (TC11), the early elongation complex with Pol II…
7NVS 2.8 Å, RNA polymerase II core pre-initiation complex with closed promoter DNA in proximal…
8WAT 2.82 Å, De novo transcribing complex 10 (TC10), the early elongation complex with Pol II…
8WAY 2.85 Å, De novo transcribing complex 15 (TC15), the early elongation complex with Pol II…
7NVT 2.9 Å, RNA polymerase II core pre-initiation complex with closed promoter DNA in distal position
8S52 2.9 Å, RNA polymerase II core initially transcribing complex with an ordered RNA of 10 nt

Browse structure collections

About this viewer

MolViewer shows 1I27 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.