8WAU: Alpha-amanitin

Name: PDB 8WAU: De novo transcribing complex 11 (TC11), the early elongation complex with Pol II positioned 11nt downstream of TSS
Published: 2023-12-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

De novo transcribing complex 11 (TC11), the early elongation complex with Pol II positioned 11nt downstream of TSS. Determined by electron microscopy at 2.78 Å resolution. Released 6 Dec 2023.

Method: Electron microscopy
Resolution: 2.78 Å
Organisms: Amanita phalloides, Homo sapiens, synthetic construct
Chains: 18
Atoms: 35,698
Mol. weight: 670.93 kDa
Ligands: MG, ZN, W0F
Released: 6 Dec 2023

Explore 8WAU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8WAU contains 190 α-helices and 243 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain o: 75 helices, 70 β-strands

Element	Residues	Length	Sheet
α-helix	14	1
β-strand	15	1	2
β-strand	20-22	3	3
β-strand	25	1	4
α-helix	26-27	2
α-helix	28-34	7
β-strand	47	1	5
β-strand	52	1	5
β-strand	86-94	9	6
α-helix	99-109	11
β-strand	110	1	7
α-helix	111	1
β-strand	117	1	7
α-helix	124-132	9
α-helix	137-148	12
β-strand	153	1	8
β-strand	187	1	8
β-strand	190-194	5	9
β-strand	197-201	5	9
β-strand	214-216	3	9
α-helix	218-226	9
α-helix	230-235	6
α-helix	245-248	4
β-strand	250-255	6	6
α-helix	256-257	2
β-strand	264-266	3	10
β-strand	270-272	3	10
α-helix	275-296	22
α-helix	302-318	17
α-helix	326-328	3
β-strand	329-331	3	11
β-strand	334-335	2	11
α-helix	339-343	5
α-helix	349-355	7
β-strand	357-358	2	12
β-strand	362-369	8	13
β-strand	377-380	4	13
α-helix	382-387	6
β-strand	389-393	5	14
α-helix	399-408	10
β-strand	416-420	5	14
β-strand	426-428	3	14
α-helix	435-438	4
β-strand	445-449	5	14
α-helix	450	1
β-strand	455-459	5	13
α-helix	466-468	3
β-strand	469-476	8	13
β-strand	482-484	3	13
α-helix	486-488	3
α-helix	489-492	4
β-strand	500-504	5	13
α-helix	509-519	11
β-strand	520	1	13
α-helix	521-524	4
β-strand	526	1	15
β-strand	533	1	15
α-helix	540-548	9
β-strand	554-555	2	16
α-helix	557-565	9
α-helix	574	1
β-strand	575	1	17
α-helix	576-577	2
β-strand	579-581	3	18
β-strand	585	1	18
β-strand	586-587	2	16
α-helix	588-595	8
β-strand	602-604	3	19
α-helix	611-615	5
β-strand	628-631	4	19
β-strand	634-638	5	19
α-helix	642-645	4
α-helix	652-660	9
α-helix	662-683	22
β-strand	686	1	20
α-helix	689-692	4
α-helix	696-721	26
α-helix	727-728	2
α-helix	733-759	27
α-helix	765-772	8
α-helix	778-785	8
β-strand	789-790	2	21
β-strand	792-793	2	22
β-strand	796-797	2	22
α-helix	799	1
β-strand	802	1	23
β-strand	805	1	23
α-helix	811	1
α-helix	817-820	4
β-strand	822-823	2	21
α-helix	833-867	35
β-strand	872-873	2	24
β-strand	879-880	2	24
β-strand	886-888	3	24
α-helix	891-893	3
β-strand	896	1	25
β-strand	902-905	4	26
α-helix	913-920	8
α-helix	927-933	7
β-strand	934	1	27
α-helix	936-944	9
α-helix	946-969	24
β-strand	976-979	4	26
α-helix	983-993	11
β-strand	1002	1	27
α-helix	1006-1018	13
α-helix	1028-1037	10
α-helix	1039-1048	10
α-helix	1051-1052	2
α-helix	1053-1058	6
α-helix	1062-1079	18
β-strand	1080	1	25
α-helix	1081-1082	2
α-helix	1087-1099	13
α-helix	1121-1129	9
β-strand	1138-1142	5	28
α-helix	1151-1161	11
β-strand	1164	1	29
α-helix	1166-1169	4
β-strand	1170-1177	8	30
α-helix	1189-1198	10
β-strand	1210-1216	7	30
α-helix	1218-1223	6
α-helix	1228-1239	12
β-strand	1244-1247	4	30
β-strand	1255-1260	6	30
α-helix	1263-1267	5
α-helix	1282-1295	14
β-strand	1299	1	29
β-strand	1306-1310	5	28
β-strand	1319-1322	4	31
β-strand	1328-1331	4	31
β-strand	1335-1339	5	28
α-helix	1343-1347	5
β-strand	1358-1359	2	28
α-helix	1362-1369	8
α-helix	1371-1387	17
α-helix	1395-1406	12
α-helix	1416-1419	4
α-helix	1426-1431	6
α-helix	1436-1445	10
β-strand	1448-1449	2	3
α-helix	1454-1459	6
β-strand	1471-1475	5	32
α-helix	1477-1481	5

Chain p: 54 helices, 82 β-strands

Element	Residues	Length	Sheet
α-helix	22-36	15
α-helix	41-49	9
α-helix	50-55	6
α-helix	56-61	6
α-helix	63-64	2
β-strand	65-67	3	33
β-strand	83-93	11	33
α-helix	94	1
α-helix	96	1
β-strand	97-99	3	34
β-strand	105-107	3	34
α-helix	110-115	6
β-strand	121-133	13	33
β-strand	140-153	14	33
α-helix	154-155	2
α-helix	168-173	6
β-strand	185-187	3	35
β-strand	190-193	4	35
α-helix	194-195	2
β-strand	196-200	5	36
α-helix	201	1
β-strand	205-208	4	37
β-strand	215-223	9	37
β-strand	233-240	8	37
α-helix	241	1
α-helix	247-252	6
β-strand	256-259	4	37
β-strand	263	1	38
β-strand	267-268	2	37
α-helix	269-275	7
α-helix	281-288	8
α-helix	295-307	13
α-helix	314-323	10
β-strand	325	1	38
α-helix	332-345	14
α-helix	358-377	20
α-helix	381-384	4
α-helix	388-390	3
β-strand	391-394	4	36
α-helix	396-425	30
α-helix	431-434	4
α-helix	437-450	14
β-strand	452-453	2	39
β-strand	463-464	2	39
β-strand	468-469	2	35
α-helix	470-471	2
α-helix	475-482	8
β-strand	484-486	3	36
α-helix	503-505	3
β-strand	509	1	40
β-strand	523-525	3	36
β-strand	526	1	40
β-strand	531-532	2	41
α-helix	539-548	10
β-strand	551	1	42
β-strand	566-567	2	42
β-strand	569	1	43
β-strand	571	1	43
β-strand	576	1	42
α-helix	580-593	14
β-strand	602	1	44
β-strand	605-606	2	42
β-strand	611-612	2	42
β-strand	615	1	44
β-strand	621-627	7	41
β-strand	628-629	2	45
β-strand	632-633	2	45
α-helix	637-644	8
α-helix	653-658	6
β-strand	662-666	5	41
α-helix	667-670	4
β-strand	675-676	2	41
α-helix	679-683	5
β-strand	695-696	2	41
α-helix	700-703	4
α-helix	714-716	3
α-helix	719-729	11
β-strand	732	1	46
β-strand	748-751	4	47
β-strand	755	1	48
β-strand	759-760	2	49
α-helix	762-767	6
β-strand	776-782	7	50
β-strand	783	1	20
β-strand	794-797	4	50
α-helix	798-802	5
β-strand	808-817	10	47
β-strand	820	1	51
β-strand	826	1	51
β-strand	827-829	3	52
β-strand	848	1	53
β-strand	853	1	54
β-strand	854	1	53
α-helix	855	1
β-strand	859-860	2	47
β-strand	865-867	3	54
β-strand	869-872	4	52
β-strand	889-891	3	52
β-strand	894-895	2	54
α-helix	896-897	2
β-strand	902-911	10	47
β-strand	917-927	11	47
β-strand	934-937	4	50
β-strand	942-949	8	50
β-strand	956	1	55
β-strand	965-967	3	50
α-helix	971-975	5
α-helix	978-993	16
β-strand	997-998	2	49
α-helix	1008-1017	10
β-strand	1025-1026	2	50
α-helix	1028	1
β-strand	1029	1	55
α-helix	1030	1
α-helix	1035	1
β-strand	1036	1	55
α-helix	1037	1
β-strand	1041-1050	10	50
β-strand	1051	1	46
α-helix	1055-1058	4
β-strand	1060-1061	2	13
β-strand	1067	1	56
β-strand	1074	1	56
β-strand	1085-1086	2	12
α-helix	1088-1097	10
α-helix	1100-1104	5
α-helix	1105-1109	5
α-helix	1110-1111	2
β-strand	1113-1119	7	2
β-strand	1125	1	2
β-strand	1127-1129	3	57
β-strand	1134-1136	3	57
β-strand	1146-1152	7	2
α-helix	1153-1164	12
β-strand	1167	1	4
β-strand	1170-1172	3	3

Chain q: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	8-15	8	58
β-strand	18-24	7	58
α-helix	28-40	13
β-strand	44-55	12	59
α-helix	61-70	10
α-helix	78-81	4
α-helix	83-84	2
β-strand	98-106	9	59
α-helix	112	1
β-strand	113-116	4	60
α-helix	117-119	3
β-strand	121-122	2	59
β-strand	149-153	5	60
β-strand	158-168	11	59
α-helix	174-176	3
β-strand	179-185	7	58
α-helix	200-202	3
α-helix	204-206	3
α-helix	218-220	3
β-strand	229-235	7	58
α-helix	241-270	30

Chain r: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	61
β-strand	30-31	2	32
α-helix	34-50	17
α-helix	55-58	4
α-helix	59-70	12
α-helix	77-89	13
α-helix	94-103	10
α-helix	108-114	7
α-helix	116-118	3
β-strand	119	1	62
β-strand	122	1	62
α-helix	124-137	14

Chain s: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	3-23	21
β-strand	26	1	63
α-helix	30-33	4
α-helix	37-44	8
β-strand	60-62	3	64
β-strand	64	1	63
β-strand	72-75	4	64
β-strand	81-82	2	65
α-helix	84-97	14
β-strand	101-106	6	64
β-strand	109-110	2	65
α-helix	112-120	9
β-strand	126-131	6	64
α-helix	134-136	3
α-helix	139-141	3
β-strand	147-150	4	66
α-helix	151-152	2
α-helix	153-162	10
β-strand	172-173	2	66
α-helix	178-183	6
β-strand	190-195	6	66
β-strand	203-209	7	66

Chain S: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	11-17	7	1
β-strand	25-32	8	1
α-helix	33-35	3
β-strand	45-49	5	1
β-strand	98-102	5	1
β-strand	109-114	6	1
β-strand	123-128	6	1
β-strand	135-139	5	1
β-strand	142-149	8	1
α-helix	157-165	9
α-helix	173-179	7

Chain t: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	56	1	67
α-helix	57-58	2
α-helix	59-74	16
α-helix	77-79	3
α-helix	89-99	11
β-strand	104-109	6	32
α-helix	110	1
β-strand	115-119	5	32
β-strand	124	1	67
α-helix	125	1

Chain T: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
β-strand	8	1	1
α-helix	10-14	5
β-strand	17-23	7	1
α-helix	25-34	10
β-strand	41-47	7	1
β-strand	52-58	7	1
α-helix	59	1
α-helix	60-63	4
β-strand	81-86	6	1
β-strand	91-98	8	1
β-strand	104-116	13	1

6 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-amanitin	N	protein	8	Amanita phalloides	P85421 (AlphaFold model)
General transcription factor IIF subunit 1	S	protein	517	Homo sapiens	P35269 (AlphaFold model)
General transcription factor IIF subunit 2	T	protein	249	Homo sapiens	P13984 (AlphaFold model)
non-template DNA	X	DNA	99	synthetic construct
template DNA	Y	DNA	99	synthetic construct
RNA	Z	RNA	11	synthetic construct
DNA-directed RNA polymerase subunit	o	protein	1970	Sus scrofa	A0A8D1DPV6
DNA-directed RNA polymerase subunit beta	p	protein	1174	Sus scrofa	I3LGP4
DNA-directed RNA polymerase II subunit RPB3	q	protein	275	Sus scrofa	I3LCH3
DNA-directed RNA polymerase II subunit RPB4	r	protein	142	Sus scrofa	A0A4X1VM56
DNA-directed RNA polymerase II subunit E	s	protein	210	Sus scrofa	I3LSI7
DNA-directed RNA polymerase II subunit F	t	protein	127	Sus scrofa	A0A4X1VEK9

6 more molecules are not listed.

Sequence of entity 1 (N), FASTA

>8WAU_1 Alpha-amanitin (chains N)
IWGIGCNP

Sequence of entity 2 (S), FASTA

>8WAU_2 General transcription factor IIF subunit 1 (chains S)
MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEE
EMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTE
NTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQR
RLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPL
AKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKG
VDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSA
LFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAA
KRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTK
KTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE

Sequence of entity 3 (T), FASTA

>8WAU_3 General transcription factor IIF subunit 2 (chains T)
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNE
DLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAA
SENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADK
QHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYR
HYQGEEKSD

Sequence of entity 4 (X), FASTA

>8WAU_4 non-template DNA (chains X)
AAGGGCGCCTATAAAAGGGGGTGGTTGTGAGTTCTTCTTCATCAACTTCAGGTACTTCGA
GCCGAGCAGACGTGCCTACGGACCATGTCCGAAACTGAC

Sequence of entity 5 (Y), FASTA

>8WAU_5 template DNA (chains Y)
GTCAGTTTCGGACATGGTCCGTAGGCACGTCTGCTCGGCTCGAAGTACCTGAAGTTGATG
AAGAAGAACTCACAACCACCCCCTTTTATAGGCGCCCTT

Sequence of entity 6 (Z), FASTA

>8WAU_6 RNA (chains Z)
XUCAACUUCAG

Sequence of entity 7 (o), FASTA

>8WAU_7 DNA-directed RNA polymerase subunit (chains o)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Sequence of entity 8 (p), FASTA

>8WAU_8 DNA-directed RNA polymerase subunit beta (chains p)
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Sequence of entity 9 (q), FASTA

>8WAU_9 DNA-directed RNA polymerase II subunit RPB3 (chains q)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Sequence of entity 10 (r), FASTA

>8WAU_10 DNA-directed RNA polymerase II subunit RPB4 (chains r)
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY

Sequence of entity 11 (s), FASTA

>8WAU_11 DNA-directed RNA polymerase II subunit E (chains s)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Sequence of entity 12 (t), FASTA

>8WAU_12 DNA-directed RNA polymerase II subunit F (chains t)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ZN	Zinc ion	Zn	8
W0F	[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-met…	C11 H18 N5 O14 P3	1

Primary citation

Structural visualization of transcription initiation in action. Chen, X., Liu, W., Wang, Q. et al. Science (2023) 382:eadi5120-eadi5120. DOI 10.1126/science.adi5120 · PubMed

Other PDB entries of the same protein (UniProt P85421 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8WAV 2.72 Å, De novo transcribing complex 12 (TC12), the early elongation complex with Pol II…
8WAX 2.75 Å, De novo transcribing complex 14 (TC14), the early elongation complex with Pol II…
8WAZ 2.76 Å, De novo transcribing complex 16 (TC16), the early elongation complex with Pol II…
1K83 2.8 Å, Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin
3CQZ 2.8 Å, Crystal structure of 10 subunit RNA polymerase II in complex with the inhibitor…
8WAT 2.82 Å, De novo transcribing complex 10 (TC10), the early elongation complex with Pol II…
8WAY 2.85 Å, De novo transcribing complex 15 (TC15), the early elongation complex with Pol II…
8WB0 2.94 Å, De novo transcribing complex 17 (TC17), the early elongation complex with Pol II…
8WAW 3.02 Å, De novo transcribing complex 13 (TC13), the early elongation complex with Pol II…
2VUM 3.4 Å, Alpha-amanitin inhibited complete RNA polymerase II elongation complex
6EXV 3.6 Å, Structure of mammalian RNA polymerase II elongation complex inhibited by Alpha-amanitin
8WAK 5.47 Å, Structure of transcribing complex 2 (TC2), the initially transcribing complex with Pol…

Browse structure collections

About this viewer

MolViewer shows 8WAU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.