1I5H: RNEDD4 wwiii domain-renal BP2 peptide complex

Solution structure of the RNEDD4 wwiii domain-renal BP2 peptide complex. Determined by solution NMR. Released 2 May 2001.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 2
Atoms: 522
Mol. weight: 7.39 kDa
Released: 2 May 2001

Explore 1I5H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1I5H contains 0 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain W: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	465-469	5	1
β-strand	475-479	5	1
β-strand	484-486	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin ligase NEDD4	W	protein	50	Rattus norvegicus	Q62940 (AlphaFold model)
Amiloride-sensitive sodium channel beta-subunit	B	protein	17	Rattus norvegicus	P37090 (AlphaFold model)

Sequence of entity 1 (W), FASTA

>1I5H_1 UBIQUITIN LIGASE NEDD4 (chains W)
GSPVDSNDLGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRMQNVAITG

Sequence of entity 2 (B), FASTA

>1I5H_2 AMILORIDE-SENSITIVE SODIUM CHANNEL BETA-SUBUNIT (chains B)
GSTLPIPGTPPPNYDSL

Primary citation

Solution structure of a Nedd4 WW domain-ENaC peptide complex. Kanelis, V., Rotin, D., Forman-Kay, J.D. Nat Struct Biol (2001) 8:407-412. DOI 10.1038/87562 · PubMed

Other PDB entries of the same protein (UniProt Q62940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2N8S Solution Structure of the rNedd4 WW1 Domain by NMR
2N8T Solution Structure of the rNedd4 WW2 Domain-Cx43CT Peptide Complex by NMR
2N8U Solution Structure of the rNedd4 WW2 Domain by NMR

Browse structure collections

About this viewer

MolViewer shows 1I5H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.