Solution Structure of the rNedd4 WW2 Domain by NMR. Determined by solution NMR. Released 24 Feb 2016.
Explore 2N8U in 3D Show helices and sheets RCSB PDB PDBe
2N8U contains 1 α-helix and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-14 | 5 | 1 |
| α-helix | 19 | 1 | |
| β-strand | 20-24 | 5 | 1 |
| β-strand | 29-31 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase NEDD4 | A | protein | 39 | Rattus norvegicus | Q62940 (AlphaFold model) |
>2N8U_1 E3 ubiquitin-protein ligase NEDD4 (chains A) GSSSGLPPGWEEKQDDRGRSYYVDHNSKTTTWSKPTMQD
Structural Studies of the Nedd4 WW Domains and Their Selectivity for the Connexin43 (Cx43) Carboxyl Terminus. Spagnol, G., Kieken, F., Kopanic, J.L. et al. J Biol Chem (2016) 291:7637-7650. DOI 10.1074/jbc.M115.701417 · PubMed
Other PDB entries of the same protein (UniProt Q62940 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2N8U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.