2N8T: RNedd4 WW2 Domain-Cx43CT Peptide Complex by NMR

Solution Structure of the rNedd4 WW2 Domain-Cx43CT Peptide Complex by NMR. Determined by solution NMR. Released 24 Feb 2016.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 2
Atoms: 422
Mol. weight: 6.05 kDa
Released: 24 Feb 2016

Explore 2N8T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N8T contains 1 α-helix and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	10-14	5	1
β-strand	20-24	5	1
β-strand	29-30	2	1

Chain B: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
α-helix	43-45	3
β-strand	49	1	2
β-strand	52	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase NEDD4	A	protein	39	Rattus norvegicus	Q62940 (AlphaFold model)
Cx43CT Peptide	B	protein	14		P08050 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2N8T_1 E3 ubiquitin-protein ligase NEDD4 (chains A)
GSSSGLPPGWEEKQDDRGRSYYVDHNSKTTTWSKPTMQD

Sequence of entity 2 (B), FASTA

>2N8T_2 Cx43CT Peptide (chains B)
APLSPMSPPGYKLV

Primary citation

Structural Studies of the Nedd4 WW Domains and Their Selectivity for the Connexin43 (Cx43) Carboxyl Terminus. Spagnol, G., Kieken, F., Kopanic, J.L. et al. J Biol Chem (2016) 291:7637-7650. DOI 10.1074/jbc.M115.701417 · PubMed

Other PDB entries of the same protein (UniProt Q62940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1I5H Solution structure of the RNEDD4 wwiii domain-renal BP2 peptide complex
2N8S Solution Structure of the rNedd4 WW1 Domain by NMR
2N8U Solution Structure of the rNedd4 WW2 Domain by NMR

Browse structure collections

About this viewer

MolViewer shows 2N8T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.