1I6Z: Bag domain of BAG1 cochaperone

Name: PDB 1I6Z: Bag domain of BAG1 cochaperone
Published: 2001-09-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Bag domain of BAG1 cochaperone. Determined by solution NMR. Released 6 Sept 2001.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 1,084
Mol. weight: 15.51 kDa
Released: 6 Sept 2001

Explore 1I6Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1I6Z contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	98-132	35
α-helix	138-167	30
α-helix	176-210	35

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bag-family molecular chaperone regulator-1	A	protein	135	Mus musculus	Q60739 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1I6Z_1 BAG-FAMILY MOLECULAR CHAPERONE REGULATOR-1 (chains A)
GSPEFMLIGEKSNPEEEVELKKLKDLEVSAEKIANHLQELNKELSGIQQGFLAKELQAEA
LCKLDRKVKATIEQFMKILEEIDTMVLPEQFKDSRLKRKNLVKKVQVFLAECDTVEQYIC
QETERLQSTNLALAE

Primary citation

Structural analysis of BAG1 cochaperone and its interactions with Hsc70 heat shock protein. Briknarova, K., Takayama, S., Brive, L. et al. Nat Struct Biol (2001) 8:349-352. DOI 10.1038/86236 · PubMed

Other PDB entries of the same protein (UniProt Q60739 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2LWP The NMR solution structure of the the ubiquitin homology domain of mouse BAG-1
2M8S NMR Structure of the Cytoplasmic Tail of the Membrane Form of Heparin-binding EGF-like…

Browse structure collections

About this viewer

MolViewer shows 1I6Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.