2M8S: BAG family molecular chaperone regulator 1

NMR Structure of the Cytoplasmic Tail of the Membrane Form of Heparin-binding EGF-like Growth Factor (proHB-EGF-CT) Complexed with the Ubiquitin Homology Domain of Bcl-2-associated Athanogene 1 from Mus musculus (mBAG-1-UBH). Determined by solution NMR. Released 16 Apr 2014.

Method: Solution NMR
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 953
Mol. weight: 13.68 kDa
Released: 16 Apr 2014

Explore 2M8S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M8S contains 3 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	19-24	6	1
β-strand	27-32	6	1
β-strand	38	1	2
β-strand	41	1	2
α-helix	46-53	8
α-helix	59-61	3
β-strand	64	1	3
β-strand	65-66	2	4
β-strand	69-70	2	4
α-helix	78-80	3
β-strand	88-90	3	1
β-strand	91	1	3

Chain B: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	190	1	5
β-strand	192	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BAG family molecular chaperone regulator 1	A	protein	97	Mus musculus	Q60739 (AlphaFold model)
Proheparin-binding EGF-like growth factor	B	protein	24	Homo sapiens	Q99075 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M8S_1 BAG family molecular chaperone regulator 1 (chains A)
MAKTEEMVQTEEMETPRLSVIVTHSNERYDLLVTPQQGNSEPVVQDLAQLVEEATGVPLP
FQKLIFKGKSLKEMETPLSALGMQNGCRVMLIGEKSN

Sequence of entity 2 (B), FASTA

>2M8S_2 Proheparin-binding EGF-like growth factor (chains B)
RYHRRGGYDVENEEKVKLGMTNSH

Primary citation

Nuclear Magnetic Resonance Structure of the Cytoplasmic Tail of Heparin Binding EGF-like Growth Factor (proHB-EGF-CT) Complexed with the Ubiquitin Homology Domain of Bcl-2-Associated Athanogene 1 from Mus musculus (mBAG-1-UBH). Hung, K.W., Huang, H.W., Cho, C.C. et al. Biochemistry (2014) 53:1935-1946. DOI 10.1021/bi5003019 · PubMed

Other PDB entries of the same protein (UniProt Q60739 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1I6Z Bag domain of BAG1 cochaperone
2LWP The NMR solution structure of the the ubiquitin homology domain of mouse BAG-1

Browse structure collections

About this viewer

MolViewer shows 2M8S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.