The NMR solution structure of the the ubiquitin homology domain of mouse BAG-1. Determined by solution NMR. Released 19 Jun 2013.
Explore 2LWP in 3D Show helices and sheets RCSB PDB PDBe
2LWP contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 19-24 | 6 | 1 |
| β-strand | 27-32 | 6 | 1 |
| α-helix | 44-55 | 12 | |
| α-helix | 59-61 | 3 | |
| β-strand | 64-66 | 3 | 1 |
| β-strand | 69-70 | 2 | 1 |
| β-strand | 88-91 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| BAG family molecular chaperone regulator 1 | A | protein | 97 | Mus musculus | Q60739 (AlphaFold model) |
>2LWP_1 BAG family molecular chaperone regulator 1 (chains A) MAKTEEMVQTEEMETPRLSVIVTHSNERYDLLVTPQQGNSEPVVQDLAQLVEEATGVPLP FQKLIFKGKSLKEMETPLSALGMQNGCRVMLIGEKSN
The NMR solution structure of the ubiquitin homology domain of Bcl-2-associated athanogene 1 (BAG-1-UBH) from Mus musculus. Huang, H.W., Yu, C. Biochem Biophys Res Commun (2013) 431:86-91. DOI 10.1016/j.bbrc.2012.12.082 · PubMed
Other PDB entries of the same protein (UniProt Q60739 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2LWP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.