1I9B: Acetylcholine binding protein

X-ray structure of acetylcholine binding protein (ACHBP). Determined by X-ray diffraction at 2.7 Å resolution. Released 16 May 2001.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Lymnaea stagnalis
Chains: 5
Atoms: 8,299
Mol. weight: 124.95 kDa
Ligands: CA
Released: 16 May 2001

Explore 1I9B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1I9B contains 20 α-helices and 75 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D and E: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
β-strand	22	1	1
β-strand	25	1	1
α-helix	26	1
β-strand	27-42	16	2
β-strand	47-59	13	2
α-helix	61-63	3
β-strand	73-77	5	2
α-helix	78-80	3
β-strand	86-88	3	3
β-strand	91	1	2
β-strand	96-97	2	2
β-strand	102-106	5	2
β-strand	110-113	4	2
β-strand	116-122	7	2
β-strand	134-142	9	3
β-strand	150-153	4	2
β-strand	171-185	15	3
β-strand	188-203	16	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acetylcholine binding protein	A, B, C, D, E	protein	217	Lymnaea stagnalis	P58154 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>1I9B_1 ACETYLCHOLINE BINDING PROTEIN (chains A, B, C, D, E)
EAEAYVEFDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFW
QQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLY
MPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEI
LDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	8

Water and common crystallization additives (EPE) are not listed.

Primary citation

Crystal structure of an ACh-binding protein reveals the ligand-binding domain of nicotinic receptors. Brejc, K., van Dijk, W.J., Klaassen, R.V. et al. Nature (2001) 411:269-276. DOI 10.1038/35077011 · PubMed

Other PDB entries of the same protein (UniProt P58154 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NDV 1.7 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL001888.
4ZK1 1.75 Å, Crystal Structure of Lymnaea stagnalis Acetylcholine-Binding Protein (LsAChBP) in…
4ZJT 1.85 Å, X-ray crystal structure of Lymnaea stagnalis acetylcholine binding protein (LsAChBP) in…
4ZRU 1.9 Å, X-ray crystal structure of Lymnaea stagnalis acetylcholine binding protein (Ls-AChBP) in…
8P11 1.9 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL003044.
7NDP 2.0 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL001856.
7PD6 2.0 Å, Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP)…
7PE6 2.01 Å, Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP)…
5J5G 2.04 Å, X-Ray Crystal Structure of Acetylcholine Binding Protein (AChBP) in Complex with…
5J5F 2.04 Å, X-Ray Crystal Structure of Acetylcholine Binding Protein (AChBP) in Complex with…
3WTN 2.09 Å, Crystal Structure of Lymnaea stagnalis Acetylcholine Binding Protein Complexed with…
4QAC 2.1 Å, X-RAY STRUCTURE OF ACETYLCHOLINE BINDING PROTEIN (ACHBP) IN COMPLEX WITH…

Browse more

1I9B is part of these collections:

Neurotransmission and the synapse

About this viewer

MolViewer shows 1I9B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.