1ICH: Tumor necrosis factor receptor-1 death domain

Solution structure of the tumor necrosis factor receptor-1 death domain. Determined by solution NMR. Released 1 Apr 2002.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 714
Mol. weight: 12.81 kDa
Released: 1 Apr 2002

Explore 1ICH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ICH contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	328-336	9
α-helix	342-349	8
α-helix	353-362	10
α-helix	367-381	15
α-helix	388-398	11
α-helix	402-412	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor receptor-1	A	protein	112	Homo sapiens	P19438 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ICH_1 TUMOR NECROSIS FACTOR RECEPTOR-1 (chains A)
MAHKPQSLDTDDPATLYAVVENVPPLRWKEFVKRLGLSDHEIDRLELQNGRCLREAQYSM
LATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR

Primary citation

Solution structure of the tumor necrosis factor receptor-1 death domain. Sukits, S.F., Lin, L.L., Hsu, S. et al. J Mol Biol (2001) 310:895-906. DOI 10.1006/jmbi.2001.4790 · PubMed

Other PDB entries of the same protein (UniProt P19438 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8P6Q 1.4 Å, Racemic structure of TNFR1 cysteine-rich domain
9S3I 1.64 Å, Crystal structure of the human tumor necrosis factor receptor 1 extracellular domain at…
9S3J 1.77 Å, Crystal structure of the human tumor necrosis factor receptor 1 extracellular domain in…
1EXT 1.85 Å, Extracellular domain of the 55KDA tumor necrosis factor receptor. Crystallized at PH3.7…
1NCF 2.25 Å, A new paradigm for tumor necrosis factor signalling
8ZUI 2.56 Å, Binary cluster of TNF-TNFR1 ectodomain complex
9V9C 2.62 Å, Cryo-EM structure of human TNFR1 DD filament
7KP7 2.65 Å, asymmetric mTNF-alpha hTNFR1 complex
1TNR 2.85 Å, Crystal structure of the soluble human 55 kd tnf receptor-human tnf-beta complex:…
1FT4 2.9 Å, Photochemically-enhanced binding of small molecules to the tumor necrosis factor…
7KPB 3.0 Å, Human TNF-alpha TNFR1 complex bound to conformationally selective antibody
7KP8 3.15 Å, asymmetric mTNF-alpha hTNFR1 complex

Browse structure collections

About this viewer

MolViewer shows 1ICH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.