1IHR: Dimeric C-terminal domain of TonB

Crystal structure of the dimeric C-terminal domain of TonB. Determined by X-ray diffraction at 1.55 Å resolution. Released 1 Aug 2001.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,397
Mol. weight: 17.45 kDa
Released: 1 Aug 2001

Explore 1IHR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IHR contains 4 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	169-182	14	1
β-strand	188-194	7	1
α-helix	198	1
α-helix	201-209	9
α-helix	210-212	3
β-strand	221-236	16	1

Chain B: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	169-182	14	1
β-strand	188-194	7	1
α-helix	201-210	10
β-strand	221-236	16	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TonB protein	A, B	protein	76	Escherichia coli	P02929 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1IHR_1 TonB protein (chains A, B)
PARAQALRIEGQVKVKFDVTPDGRVDNVQILSAKPANMFEREVKNAMRRWRYEPGKPGSG
IVVNILFKINGTTEIQ

Primary citation

Crystal structure of the dimeric C-terminal domain of TonB reveals a novel fold. Chang, C., Mooser, A., Pluckthun, A. et al. J Biol Chem (2001) 276:27535-27540. DOI 10.1074/jbc.M102778200 · PubMed

Other PDB entries of the same protein (UniProt P02929 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1U07 1.13 Å, Crystal Structure of the 92-residue C-term. part of TonB with significant structural…
8VGC 1.42 Å, Complex of ExbD with D-box peptide: Orthorhombic form
8VGD 1.42 Å, Complex of ExbD with D-box peptide: Tetragonal form
8P9R 1.52 Å, Structure of the periplasmic domain of ExbD from E. coli in complex with TonB
2GSK 2.1 Å, Structure of the BtuB:TonB Complex
1QXX 2.7 Å, Crystal structure of the C-terminal domain of tonb
9DDO 2.8 Å, E. coli TonB-ExbBD TonB bound to ExbB chain C
9DDP 3.16 Å, E. coli TonB-ExbBD TonB bound to ExbB chain E
9DDQ 3.19 Å, E. coli TonB-ExbBD TonB bound to ExbB chain A
2GRX 3.3 Å, Crystal structure of TonB in complex with FhuA, E. coli outer membrane receptor for…
1XX3 Solution Structure of Escherichia coli TonB-CTD

Browse structure collections

About this viewer

MolViewer shows 1IHR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.