1QXX: C-terminal domain of tonb

Crystal structure of the C-terminal domain of tonb. Determined by X-ray diffraction at 2.7 Å resolution. Released 6 Apr 2004.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Escherichia coli
Chains: 1
Atoms: 632
Mol. weight: 8.56 kDa
Released: 6 Apr 2004

Explore 1QXX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QXX contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	177-182	6	1
β-strand	188-194	7	1
α-helix	202-209	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TonB protein	A	protein	76	Escherichia coli	P02929 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QXX_1 TonB protein (chains A)
PARAQALRIEGQVKVKFDVTPDGRVDNVQILSAKPANMFEREVKNAMRRWRYEPGKPGSG
IVVNILFKINGTTEIQ

Primary citation

Dimerization of TonB is not essential for its binding to the outer membrane siderophore receptor FhuA of Escherichia coli. Koedding, J., Howard, P., Kaufmann, L. et al. J Biol Chem (2004) 279:9978-9986. DOI 10.1074/jbc.M311720200 · PubMed

Other PDB entries of the same protein (UniProt P02929 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1U07 1.13 Å, Crystal Structure of the 92-residue C-term. part of TonB with significant structural…
8VGC 1.42 Å, Complex of ExbD with D-box peptide: Orthorhombic form
8VGD 1.42 Å, Complex of ExbD with D-box peptide: Tetragonal form
8P9R 1.52 Å, Structure of the periplasmic domain of ExbD from E. coli in complex with TonB
1IHR 1.55 Å, Crystal structure of the dimeric C-terminal domain of TonB
2GSK 2.1 Å, Structure of the BtuB:TonB Complex
9DDO 2.8 Å, E. coli TonB-ExbBD TonB bound to ExbB chain C
9DDP 3.16 Å, E. coli TonB-ExbBD TonB bound to ExbB chain E
9DDQ 3.19 Å, E. coli TonB-ExbBD TonB bound to ExbB chain A
2GRX 3.3 Å, Crystal structure of TonB in complex with FhuA, E. coli outer membrane receptor for…
1XX3 Solution Structure of Escherichia coli TonB-CTD

Browse structure collections

About this viewer

MolViewer shows 1QXX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.