1XX3: Escherichia coli TonB-CTD

Solution Structure of Escherichia coli TonB-CTD. Determined by solution NMR. Released 15 Feb 2005.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 705
Mol. weight: 16.04 kDa
Released: 15 Feb 2005

Explore 1XX3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XX3 contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	154	1
β-strand	155-157	3	1
α-helix	159-164	6
α-helix	165-168	4
β-strand	174-182	9	2
β-strand	187	1	1
β-strand	188-195	8	2
α-helix	199-210	12
β-strand	214-215	2	1
β-strand	221-231	11	2
β-strand	235-238	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TonB protein	A	protein	144	Escherichia coli	P02929 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1XX3_1 TonB protein (chains A)
MHHHHHHVKKVQEQPKRDVKPVESRPASPFENTAPARLTSSTATAATSKPVTSVASGPRA
LSRNQPQYPARAQALRIEGQVKVKFDVTPDGRVDNVQILSAKPANMFEREVKNAMRRWRY
EPGKPGSGIVVNILFKINGTTEIQ

Primary citation

The solution structure of the C-terminal domain of TonB and interaction studies with TonB box peptides. Peacock, R.S., Weljie, A.M., Howard, S.P. et al. J Mol Biol (2005) 345:1185-1197. DOI 10.1016/j.jmb.2004.11.026 · PubMed

Other PDB entries of the same protein (UniProt P02929 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1U07 1.13 Å, Crystal Structure of the 92-residue C-term. part of TonB with significant structural…
8VGC 1.42 Å, Complex of ExbD with D-box peptide: Orthorhombic form
8VGD 1.42 Å, Complex of ExbD with D-box peptide: Tetragonal form
8P9R 1.52 Å, Structure of the periplasmic domain of ExbD from E. coli in complex with TonB
1IHR 1.55 Å, Crystal structure of the dimeric C-terminal domain of TonB
2GSK 2.1 Å, Structure of the BtuB:TonB Complex
1QXX 2.7 Å, Crystal structure of the C-terminal domain of tonb
9DDO 2.8 Å, E. coli TonB-ExbBD TonB bound to ExbB chain C
9DDP 3.16 Å, E. coli TonB-ExbBD TonB bound to ExbB chain E
9DDQ 3.19 Å, E. coli TonB-ExbBD TonB bound to ExbB chain A
2GRX 3.3 Å, Crystal structure of TonB in complex with FhuA, E. coli outer membrane receptor for…

Browse structure collections

About this viewer

MolViewer shows 1XX3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.