1IKL: NMR study of monomeric human interleukin-8

NMR study of monomeric human interleukin-8 (minimized average structure). Determined by solution NMR. Released 15 Oct 1995.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 569
Mol. weight: 8.42 kDa
Released: 15 Oct 1995

Explore 1IKL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IKL contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	1
β-strand	22	1	2
β-strand	26-28	3	3
β-strand	38-40	3	3
β-strand	41-43	3	2
β-strand	47-49	3	2
α-helix	50	1
β-strand	51	1	1
α-helix	52	1
α-helix	56-66	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human interleukin-8 (monomeric)	A	protein	72	Homo sapiens	P10145 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1IKL_1 HUMAN INTERLEUKIN-8 (MONOMERIC) (chains A)
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQR
VVEKFLKRAENS

Primary citation

1H NMR solution structure of an active monomeric interleukin-8. Rajarathnam, K., Clark-Lewis, I., Sykes, B.D. Biochemistry (1995) 34:12983-12990. DOI 10.1021/bi00040a008 · PubMed

Other PDB entries of the same protein (UniProt P10145 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4XDX 0.95 Å, The crystal structure of soluble human interleukin 8 expressed in Pichia pastoris
5D14 1.0 Å, The atomic resolution crystal structure of human IL-8
6N2U 1.25 Å, IL-8 Structure from Bacterial Expression Source
3IL8 2.0 Å, Crystal structure of interleukin 8: symbiosis of NMR and crystallography
1ICW 2.01 Å, Interleukin-8, mutant with glu 38 replaced by cys and cys 50 replaced by ala
9YIP 2.2 Å, Crystal structure of human IL-8 in a large unit cell
6WZM 2.28 Å, LY3041658 Fab bound to CXCL8
1QE6 2.35 Å, Interleukin-8 with an added disulfide between residues 5 and 33 (L5C/H33C)
8XX6 2.99 Å, Structure of CXCR2 bound to CXCL8 (CXCR2-CXCL8-Go Full map)
8XWN 3.29 Å, Structure of CXCR2 bound to CXCL8 (Ligand-receptor focused map)
6LFO 3.4 Å, Cryo-EM structure of a class A GPCR monomer
8IC0 3.41 Å, Cryo-EM structure of CXCL8 bound C-X-C chemokine receptor 1 in complex with Gi…

Browse structure collections

About this viewer

MolViewer shows 1IKL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.