1IL6: Interleukin-6

Human interleukin-6, NMR, minimized average structure. Determined by solution NMR. Released 4 Feb 1998.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,331
Mol. weight: 21.01 kDa
Released: 4 Feb 1998

Explore 1IL6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IL6 contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	22-41	20
α-helix	43-46	4
α-helix	82-104	23
α-helix	110-130	21
α-helix	142-153	12
α-helix	157-170	14
α-helix	171-175	5
α-helix	176-184	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-6	A	protein	185	Homo sapiens	P05231 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1IL6_1 INTERLEUKIN-6 (chains A)
APVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAE
NNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMST
KVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLR
ALRQM

Primary citation

Solution structure of recombinant human interleukin-6. Xu, G.Y., Yu, H.A., Hong, J. et al. J Mol Biol (1997) 268:468-481. DOI 10.1006/jmbi.1997.0933 · PubMed

Other PDB entries of the same protein (UniProt P05231 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ALU 1.9 Å, Human interleukin-6
7NXZ 2.0 Å, Synthetic glycoform of Human Interleukin 6
4CNI 2.2 Å, Crystal structure of the Fab portion of Olokizumab in complex with IL- 6
4J4L 2.3 Å, Modular evolution and design of the protein binding interface
4NI7 2.4 Å, Crystal structure of human interleukin 6 in complex with a modified nucleotide aptamer…
4O9H 2.42 Å, Structure of Interleukin-6 in complex with a Camelid Fab fragment
8YWQ 2.51 Å, Crystal structure of the Fab fragment of the anti-IL-6 antibody I9H in complex with a…
4NI9 2.55 Å, Crystal structure of human interleukin 6 in complex with a modified nucleotide aptamer…
5FUC 2.7 Å, Biophysical and cellular characterisation of a junctional epitope antibody that locks…
4ZS7 2.93 Å, Structural mimicry of receptor interaction by antagonistic IL-6 antibodies
8YWR 2.93 Å, Crystal structure of the Fab fragment of the anti-IL-6 antibody 68F2 in complex with a…
8QY5 3.1 Å, Structure of interleukin 6.

Browse structure collections

About this viewer

MolViewer shows 1IL6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.