1IMO: Human DNA ligase iiialpha brct domain

Name: PDB 1IMO: NMR structure of human DNA ligase iiialpha brct domain
Published: 2001-05-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

NMR structure of human DNA ligase iiialpha brct domain. Determined by solution NMR. Released 25 May 2001.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 701
Mol. weight: 9.99 kDa
Released: 25 May 2001

Explore 1IMO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IMO contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	837-840	4
β-strand	855	1	1
α-helix	865-875	11
β-strand	878	1	1
β-strand	891-892	2	2
β-strand	903-904	2	2
α-helix	906-915	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA ligase III	A	protein	88	Homo sapiens	P49916 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1IMO_1 DNA LIGASE III (chains A)
GSADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGS
RDKNPAAQQVSPEWIWACIRKRRLVAPC

Primary citation

Solution structure and backbone dynamics of the human DNA ligase IIIalpha BRCT domain. Krishnan, V.V., Thornton, K.H., Thelen, M.P. et al. Biochemistry (2001) 40:13158-13166. DOI 10.1021/bi010979g · PubMed

Other PDB entries of the same protein (UniProt P49916 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PC7 1.65 Å, X-ray crystal structure of the DNA ligase III-alpha BRCT domain.
3QVG 2.26 Å, XRCC1 bound to DNA ligase
3PC8 2.31 Å, X-ray crystal structure of the heterodimeric complex of XRCC1 and DNA ligase III-alpha…
6WH1 2.4 Å, Structure of the complex of human DNA ligase III-alpha and XRCC1 BRCT domains
10YE 2.5 Å, DNA Ligase IIIa bound to nucleosome containing a nick at SHL0
10YH 2.9 Å, DNA Ligase IIIa bound to a nucleosome containing a nick at SHL-6 (composite)
10YI 2.9 Å, XRCC1-DNA Ligase IIIa complex bound to a nucleosome containing a nick at SHL-6 (composite)
10YF 3.0 Å, DNA Ligase IIIa bound to nucleosome containing a nick at SHL-2 (composite)
3L2P 3.0 Å, Human DNA Ligase III Recognizes DNA Ends by Dynamic Switching Between Two DNA Bound States
10YG 3.4 Å, DNA Ligase IIIa bound to a nucleosome containing a nick at SHL-4 (composite)
1IN1 NMR structure of human DNA ligase iiialpha brct domain
1UW0 Solution structure of the zinc-finger domain from DNA ligase IIIa

Browse structure collections

About this viewer

MolViewer shows 1IMO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.