NMR structure of human DNA ligase iiialpha brct domain. Determined by solution NMR. Released 25 May 2001.
Explore 1IMO in 3D Show helices and sheets RCSB PDB PDBe
1IMO contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 837-840 | 4 | |
| β-strand | 855 | 1 | 1 |
| α-helix | 865-875 | 11 | |
| β-strand | 878 | 1 | 1 |
| β-strand | 891-892 | 2 | 2 |
| β-strand | 903-904 | 2 | 2 |
| α-helix | 906-915 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA ligase III | A | protein | 88 | Homo sapiens | P49916 (AlphaFold model) |
>1IMO_1 DNA LIGASE III (chains A) GSADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGS RDKNPAAQQVSPEWIWACIRKRRLVAPC
Solution structure and backbone dynamics of the human DNA ligase IIIalpha BRCT domain. Krishnan, V.V., Thornton, K.H., Thelen, M.P. et al. Biochemistry (2001) 40:13158-13166. DOI 10.1021/bi010979g · PubMed
Other PDB entries of the same protein (UniProt P49916 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1IMO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.