1UW0: Zinc-finger domain from DNA ligase IIIa

Name: PDB 1UW0: Solution structure of the zinc-finger domain from DNA ligase IIIa
Published: 2004-08-05
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Solution structure of the zinc-finger domain from DNA ligase IIIa. Determined by solution NMR. Released 5 Aug 2004.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 1
Atoms: 924
Mol. weight: 13.31 kDa
Ligands: ZN
Released: 5 Aug 2004

Explore 1UW0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UW0 contains 2 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	1
β-strand	16-17	2	2
β-strand	24-25	2	2
β-strand	30-35	6	1
β-strand	36-37	2	3
β-strand	39	1	4
β-strand	41	1	4
β-strand	46-47	2	3
β-strand	50	1	1
α-helix	53-62	10
β-strand	77	1	1
α-helix	84-98	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA ligase III	A	protein	117	HOMO SAPIENS	P49916 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UW0_1 DNA LIGASE III (chains A)
MAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIGKVVPNPFSESGGDMKEWYHIKCMFEKL
ERARATTKKIEDLTELEGWEELEDNEKEQITQHIADLSSKAAGTPKKKAVVQAKLTT

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Solution Structure and DNA Binding of the Zinc-Finger Domain from DNA Ligase Iiialpha. Kulczyk, A.W., Yang, J.-C., Neuhaus, D. J Mol Biol (2004) 341:723. DOI 10.1016/J.JMB.2004.06.035 · PubMed

Other PDB entries of the same protein (UniProt P49916 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PC7 1.65 Å, X-ray crystal structure of the DNA ligase III-alpha BRCT domain.
3QVG 2.26 Å, XRCC1 bound to DNA ligase
3PC8 2.31 Å, X-ray crystal structure of the heterodimeric complex of XRCC1 and DNA ligase III-alpha…
6WH1 2.4 Å, Structure of the complex of human DNA ligase III-alpha and XRCC1 BRCT domains
10YE 2.5 Å, DNA Ligase IIIa bound to nucleosome containing a nick at SHL0
10YH 2.9 Å, DNA Ligase IIIa bound to a nucleosome containing a nick at SHL-6 (composite)
10YI 2.9 Å, XRCC1-DNA Ligase IIIa complex bound to a nucleosome containing a nick at SHL-6 (composite)
10YF 3.0 Å, DNA Ligase IIIa bound to nucleosome containing a nick at SHL-2 (composite)
3L2P 3.0 Å, Human DNA Ligase III Recognizes DNA Ends by Dynamic Switching Between Two DNA Bound States
10YG 3.4 Å, DNA Ligase IIIa bound to a nucleosome containing a nick at SHL-4 (composite)
1IMO NMR structure of human DNA ligase iiialpha brct domain
1IN1 NMR structure of human DNA ligase iiialpha brct domain

Browse structure collections

About this viewer

MolViewer shows 1UW0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.