3PC7: DNA ligase III-alpha BRCT domain

Name: PDB 3PC7: X-ray crystal structure of the DNA ligase III-alpha BRCT domain.
Published: 2011-06-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

X-ray crystal structure of the DNA ligase III-alpha BRCT domain. Determined by X-ray diffraction at 1.65 Å resolution. Released 15 Jun 2011.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,489
Mol. weight: 20 kDa
Released: 15 Jun 2011

Explore 3PC7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PC7 contains 10 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	855-856	2	1
α-helix	865-874	10
β-strand	878-879	2	1
α-helix	880-881	2
α-helix	882-887	6
β-strand	890-892	3	1
β-strand	902-904	3	1
α-helix	906-915	10

Chain B: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	855-856	2	2
α-helix	865-874	10
β-strand	878-879	2	2
α-helix	880-881	2
α-helix	882-887	6
β-strand	890-891	2	2
β-strand	902-903	2	2
α-helix	906-915	10
α-helix	919	1
α-helix	921	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA ligase 3	A, B	protein	88	Homo sapiens	P49916 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3PC7_1 DNA ligase 3 (chains A, B)
GSADETLSQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGS
RDKNPAAQQVSPEWIWACIRKRRLVAPS

Primary citation

The structural basis for partitioning of the XRCC1/DNA ligase III-{alpha} BRCT-mediated dimer complexes. Cuneo, M.J., Gabel, S.A., Krahn, J.M. et al. Nucleic Acids Res (2011) 39:7816-7827. DOI 10.1093/nar/gkr419 · PubMed

Other PDB entries of the same protein (UniProt P49916 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QVG 2.26 Å, XRCC1 bound to DNA ligase
3PC8 2.31 Å, X-ray crystal structure of the heterodimeric complex of XRCC1 and DNA ligase III-alpha…
6WH1 2.4 Å, Structure of the complex of human DNA ligase III-alpha and XRCC1 BRCT domains
10YE 2.5 Å, DNA Ligase IIIa bound to nucleosome containing a nick at SHL0
10YH 2.9 Å, DNA Ligase IIIa bound to a nucleosome containing a nick at SHL-6 (composite)
10YI 2.9 Å, XRCC1-DNA Ligase IIIa complex bound to a nucleosome containing a nick at SHL-6 (composite)
10YF 3.0 Å, DNA Ligase IIIa bound to nucleosome containing a nick at SHL-2 (composite)
3L2P 3.0 Å, Human DNA Ligase III Recognizes DNA Ends by Dynamic Switching Between Two DNA Bound States
10YG 3.4 Å, DNA Ligase IIIa bound to a nucleosome containing a nick at SHL-4 (composite)
1IMO NMR structure of human DNA ligase iiialpha brct domain
1IN1 NMR structure of human DNA ligase iiialpha brct domain
1UW0 Solution structure of the zinc-finger domain from DNA ligase IIIa

Browse structure collections

About this viewer

MolViewer shows 3PC7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.