1IR3: Phosphorylated insulin receptor tyrosine kinase

Phosphorylated insulin receptor tyrosine kinase in complex with peptide substrate and ATP analog. Determined by X-ray diffraction at 1.9 Å resolution. Released 7 Jan 1998.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,653
Mol. weight: 37.54 kDa
Ligands: MG, ANP
Released: 7 Jan 1998

Explore 1IR3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IR3 contains 21 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	982-984	3
β-strand	990	1	1
α-helix	993-995	3
β-strand	996-1004	9	1
β-strand	1009-1019	11	1
β-strand	1022-1031	10	1
α-helix	1038-1052	15
β-strand	1059	1	2
α-helix	1060-1061	2
β-strand	1062-1066	5	1
β-strand	1073-1077	5	1
β-strand	1083	1	2
α-helix	1084-1090	7
α-helix	1102	1
α-helix	1104-1105	2
α-helix	1106-1125	20
β-strand	1128-1129	2	3
α-helix	1135-1137	3
β-strand	1138-1140	3	2
β-strand	1146-1148	3	2
β-strand	1155-1156	2	3
β-strand	1163-1164	2	4
β-strand	1170-1171	2	5
α-helix	1173-1175	3
α-helix	1178-1183	6
β-strand	1185-1186	2	4
α-helix	1188-1204	17
α-helix	1207-1208	2
α-helix	1215-1223	9
α-helix	1228-1231	4
α-helix	1236-1245	10
α-helix	1250-1252	3
α-helix	1254-1255	2
α-helix	1256-1263	8
α-helix	1264-1266	3
α-helix	1271-1274	4

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	11-12	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin receptor	A	protein	306	Homo sapiens	P06213 (AlphaFold model)
Peptide substrate	B	protein	18

Sequence of entity 1 (A), FASTA

>1IR3_1 INSULIN RECEPTOR (chains A)
VFPSSVFVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESAS
LRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAEN
NPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDI
YETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQ
VLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFF
HSEENK

Sequence of entity 2 (B), FASTA

>1IR3_2 PEPTIDE SUBSTRATE (chains B)
KKKLPATGDYMNMSPVGD

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1

Primary citation

Crystal structure of the activated insulin receptor tyrosine kinase in complex with peptide substrate and ATP analog. Hubbard, S.R. EMBO J (1997) 16:5572-5581. DOI 10.1093/emboj/16.18.5572 · PubMed

Other PDB entries of the same protein (UniProt P06213 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BU3 1.65 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB peptide
5HHW 1.79 Å, Crystal structure of insulin receptor kinase domain in complex with…
4IBM 1.8 Å, Crystal structure of insulin receptor kinase domain in complex with an inhibitor Irfin-1
5U1M 1.8 Å, Structure of the IRS-1 PTB Domain Bound to the Juxtamembrane Region of the Insulin…
1P14 1.9 Å, Crystal structure of a catalytic-loop mutant of the insulin receptor tyrosine kinase
3BU6 1.95 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB phosphopeptide
1IRK 2.1 Å, Crystal structure of the tyrosine kinase domain of the human insulin receptor
3BU5 2.1 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB peptide and ATP
3EKK 2.1 Å, Insulin receptor kinase complexed with an inhibitor
8DWN 2.15 Å, Crystal structure of bis-phosphorylated insulin receptor kinase domain
3EKN 2.2 Å, Insulin receptor kinase complexed with an inhibitor
5E1S 2.26 Å, The Crystal structure of INSR Tyrosine Kinase in complex with the Inhibitor BI 885578

Browse more

1IR3 is part of these collections:

Insulin and hormones

About this viewer

MolViewer shows 1IR3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.