The Crystal structure of INSR Tyrosine Kinase in complex with the Inhibitor BI 885578. Determined by X-ray diffraction at 2.26 Å resolution. Released 14 Oct 2015.
Explore 5E1S in 3D Show helices and sheets RCSB PDB PDBe
5E1S contains 19 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 990 | 1 | 1 |
| α-helix | 993-995 | 3 | |
| β-strand | 996-1004 | 9 | 1 |
| β-strand | 1009-1016 | 8 | 1 |
| β-strand | 1024-1031 | 8 | 1 |
| α-helix | 1038-1051 | 14 | |
| β-strand | 1059 | 1 | 2 |
| α-helix | 1060-1061 | 2 | |
| β-strand | 1062-1066 | 5 | 1 |
| β-strand | 1073-1077 | 5 | 1 |
| β-strand | 1082-1083 | 2 | 2 |
| α-helix | 1084-1090 | 7 | |
| α-helix | 1102-1105 | 4 | |
| α-helix | 1106-1125 | 20 | |
| α-helix | 1135-1137 | 3 | |
| β-strand | 1138-1140 | 3 | 2 |
| β-strand | 1146-1148 | 3 | 2 |
| α-helix | 1173-1175 | 3 | |
| α-helix | 1178-1183 | 6 | |
| α-helix | 1188-1204 | 17 | |
| α-helix | 1207-1208 | 2 | |
| α-helix | 1215-1223 | 9 | |
| α-helix | 1228-1231 | 4 | |
| α-helix | 1236-1245 | 10 | |
| α-helix | 1250-1252 | 3 | |
| α-helix | 1254-1255 | 2 | |
| α-helix | 1256-1263 | 8 | |
| α-helix | 1264-1266 | 3 | |
| α-helix | 1271-1274 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Insulin receptor | A | protein | 308 | Homo sapiens | P06213 (AlphaFold model) |
>5E1S_1 Insulin receptor (chains A) GSVFPSSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNES ASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEA ENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRNLAARNCMVAHDFTVKIGDFGMTR DIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSN EQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVS FFHSEENK
| ID | Name | Formula | Copies |
|---|---|---|---|
| 5JA | (5R)-N-(1-{2-[4-(2-methoxyethyl)piperazin-1-yl]ethyl}-1H-pyrazol-3-yl)-5,8-dime… | C29 H37 N9 O | 1 |
BI 885578, a Novel IGF1R/INSR Tyrosine Kinase Inhibitor with Pharmacokinetic Properties That Dissociate Antitumor Efficacy and Perturbation of Glucose Homeostasis. Sanderson, M.P., Apgar, J., Garin-Chesa, P. et al. Mol Cancer Ther (2015) 14:2762-2772. DOI 10.1158/1535-7163.MCT-15-0539 · PubMed
Other PDB entries of the same protein (UniProt P06213 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5E1S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.