1ISE: Ribosome Recycling Factor

Crystal structure of a mutant of ribosome recycling factor from Escherichia coli, Arg132Gly. Determined by X-ray diffraction at 2.2 Å resolution. Released 7 Oct 2003.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Escherichia coli
Chains: 1
Atoms: 1,630
Mol. weight: 20.57 kDa
Released: 7 Oct 2003

Explore 1ISE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ISE contains 8 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-24	22
α-helix	34-37	4
β-strand	41-44	4	1
β-strand	47-50	4	1
α-helix	51-53	3
β-strand	55-61	7	2
β-strand	64-69	6	2
α-helix	72-74	3
α-helix	75-83	9
β-strand	92-93	2	2
β-strand	97-101	5	2
α-helix	102-106	5
α-helix	107-145	39
α-helix	150-184	35

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosome Recycling Factor	A	protein	185	Escherichia coli	P0A805 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ISE_1 Ribosome Recycling Factor (chains A)
MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVE
DSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGE
AEQARVAVRNVGRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEA
ELMQF

Primary citation

Crystal structure of a mutant of ribosome recycling factor from Escherichia coli, Arg132Gly. Nakano, H., Yoshida, T., Oka, S. et al. To be published.

Other PDB entries of the same protein (UniProt P0A805 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EK8 2.3 Å, Crystal structure of the ribosome recycling factor (RRF) from escherichia coli
4V9D 3.0 Å, Structures of the bacterial ribosome in classical and hybrid states of tRNA binding
4WOI 3.0 Å, 4,5-linked aminoglycoside antibiotics regulate the bacterial ribosome by targeting…
4V9C 3.3 Å, Allosteric control of the ribosome by small-molecule antibiotics
1Y69 3.33 Å, RRF domain I in complex with the 50S ribosomal subunit from Deinococcus radiodurans
2RDO 9.1 Å, 50S subunit with EF-G(GDPNP) and RRF bound
1ZN1 14.1 Å, Coordinates of RRF fitted into Cryo-EM map of the 70S post-termination complex
1ZN0 15.5 Å, Coordinates of RRF and EF-G fitted into Cryo-EM map of the 50S subunit bound with both…

Browse structure collections

About this viewer

MolViewer shows 1ISE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.